Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1357 IGR1359 IGR1356 IGR1364 IGR1358 IGR1361 IGR1362 IGR1360 IGR1363 IGR1355 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669
* Calculated from Protein Sequence

Gene ID: NG1666

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fabI  envM  

Definition:
enoyl-ACP reductase (FabI)

Gene Start:
1621148

Gene Stop:
1620366

Gene Length:
783

Molecular Weight*:
27676

pI*:
6.10

Net Charge*:
-2.98

EC:
1.3.1.9  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Fatty acid biosynthesis (path 1)

Secondary Evidence:
Bergler,H., Hogenauer,G. and Turnowsky,F.
Sequences of the envM gene and of two mutated alleles in
Escherichia coli
J. Gen. Microbiol. 138 (Pt 10), 2093-2100 (1992)
Medline: 93123967


Comment:
For other 'Fab' genes see NG1352 (FabF2),NG1763 (fabF),NG1804 (fabZ), NG2163 (fabG), NG2166 (fabD) and NG2168 (fabH).

Oklahoma ID: NGO.1666c

Blast Summary:  PSI-Blast Search
Residues 1-261 in NG1666 have 100% similarity to residues 1-261 in AE002390, N. meningitidis MC58 enoyl-(acyl-carrier-protein) reductase.

Numerous hits in gapped BLAST to enoyl-[acyl-carrier-protein] reductase sequences,e.g.residues 1-257 in NG1666 have 62% similarity to residues 1-256 in AE006052, P. multocida FabI.
Residues 1-258 in NG1666 have 60% similarity to residues 1-257 in
AP002556, E. coli O157:H7 enoyl-[acyl-carrier-protein] reductase.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0623
COG name: Enoyl-[acyl-carrier-protein] reductase (NADH)
Functional Class:  I
The phylogenetic pattern of COG0623 is -----q-cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 172-222 are 60% similar to a (REDUCTASE ENOYL-ACYL-CARRIER-PROTEIN NADH NADH-) protein domain (PD153947) which is seen in FABI_ECOLI.

Residues 225-254 are 83% similar to a (OXIDOREDUCTASE PROTEIN REDUCTASE NADP DEHYDROGENASE) protein domain (PD000197) which is seen in P73016_SYNY3.

Residues 196-254 are 54% similar to a (REDUCTASE PROTEIN ENOYL-ACYL-CARRIER NADH) protein domain (PD029146) which is seen in O24990_HELPY.

Residues 31-168 are 63% similar to a (REDUCTASE NADH PROTEIN ENOYL-ACP) protein domain (PD003795) which is seen in Q9ZFE4_PSEAE.

Residues 10-195 are 53% similar to a (PROTEIN OXIDOREDUCTASE DEHYDROGENASE REDUCTASE NAD NADP) protein domain (PD000038) which is seen in O67505_AQUAE.



Paralogs:  Local Blast Search


NG1666 is paralogously related to NG2163 (3-oxoacyl-[acyl-carrier protein] reductase) (1e-09).


Pfam Summary:  Pfam Search
Residues 9 to 252 (E-value = 1.8e-14) place NG1666 in the adh_short family which is described as short chain dehydrogenase (PF00106)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
21
non-globular  
83  
176

PDB Hit:
pdb|1QSG|1QSG-A CRYSTAL STRUCTURE OF ENOYL REDUCTASE INHIBITION 317.0 1e-87
pdb|1C14|1C14-A CRYSTAL STRUCTURE OF E COLI ENOYL 317.0 1e-87
pdb|1D8A|1D8A-A E. COLI ENOYL REDUCTASE/NAD+/TRICLOSAN COMPLEX 315.0 5e-87
pdb|1ENY|1ENY MOL_I

Gene Protein Sequence:
MGFLQGKKILITGMISERSIAYGIAKACREQGAELAFTYVVDKLEERVRK
MAAELDSELVFRCDVASDDEINQVFADLGKHWDGLDGLVHSIGFAPKEAL
SGDFLDSISREAFNTAHEISAYSLPALAKAARPMMRGRNSAIVALSYLGA
VRAIPNYNVMGMAKASLEAGIRFTAACLGKEGIRCNGISAGPIKTLAASG
IADFGKLLGHVAAHNPLRRNVTIEEVGNTAAFLLSDLSSGITGEITYVDG
GYSINALSTEG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTTTTCTGCAAGGCAAAAAAATTCTGATTACCGGCATGATTTCCGA
GCGTTCCATCGCTTACGGCATCGCCAAAGCCTGCCGCGAACAGGGCGCGG
AACTGGCGTTTACCTACGTTGTGGACAAACTGGAAGAGCGCGTCCGCAAA
ATGGCGGCGGAATTAGATTCCGAACTCGTATTCCGCTGCGATGTCGCCAG
CGACGACGAAATCAACCAAGTGTTCGCCGACTTAGGCAAACATTGGGATG
GCTTGGACGGTTTGGTGCATTCCATCGGCTTCGCGCCGAAAGAAGCCTTG
AGCGGCGACTTCCTCGACAGCATCAGCCGCGAAGCGTTCAACACCGCACA
CGAAATTTCCGCATACAGCCTGCCCGCATTGGCAAAAGCCGCCCGTCCGA
TGATGCGCGGCAGGAACTCCGCCATCGTCGCCCTTAGCTACTTGGGCGCG
GTACGCGCGATTCCGAATTACAACGTGATGGGTATGGCAAAAGCCAGCCT
TGAGGCAGGCATCCGCTTTACCGCCGCCTGTCTGGGTAAAGAGGGCATCC
GCTGCAACGGCATTTCCGCCGGCCCGATCAAAACGCTCGCCGCCTCCGGC
ATCGCCGATTTCGGCAAACTCTTGGGACACGTCGCCGCCCACAACCCGCT
GCGCCGCAACGTTACCATCGAAGAAGTCGGGAATACTGCCGCCTTCCTGC
TGTCCGACCTGTCGTCCGGCATTACCGGCGAAATCACTTATGTTGACGGC
GGTTACAGCATTAATGCCTTGAGCACCGAGGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy