Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1357 IGR1359 IGR1356 IGR1358 IGR1361 IGR1362 IGR1360 IGR1363 IGR1355 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669 NG1663 gloA,lguL, - NG1661 fabI,envM, - NG1666 dapD, - NG1667 NG1662 pgi, - NG1668 NG1664 ilvE, - NG1665 pilG, - NG1669
* Calculated from Protein Sequence

Gene ID: NG1665

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ilvE  

Definition:
branched-chain amino acid aminotranferase

Gene Start:
1619120

Gene Stop:
1620115

Gene Length:
996

Molecular Weight*:
36116

pI*:
5.90

Net Charge*:
-5.29

EC:
2.6.1.42  

Functional Class:
Amino acid biosynthesis; Branched chain amino acid family  

Pathway: pathway table
Pantothenate and CoA biosynthesis
Valine, leucine and isoleucine biosynthesis
Valine, leucine and isoleucine degradation

Secondary Evidence:
Cox,J.L., Cox,B.J., Fidanza,V. and Calhoun,D.H.
The complete nucleotide sequence of the ilvGMEDA cluster of Escherichia coli K-12.
Gene 56 (2-3): 185-198 (1987)
[Medline: 88056322].

Flint,D.H., Emptage,M.H., Finnegan,M.G., Fu,W. and Johnson,M.K. The role and properties of the iron-sulfur cluster in Escherichia coli dihydroxy-acid dehydratase.
J. Biol. Chem. 268 (20): 14732-14742 (1993)
[Medline: 93315441].

Brown,O.R., Smyk-Randall,E., Draczynska-Lusiak,B. and Fee,J.A. Dihydroxy-acid dehydratase, a [4Fe-4S] cluster-containing enzyme in Escherichia coli: effects of intracellular superoxide dismutase on its inactivation by oxidant stress.
Arch. Biochem. Biophys. 319 (1): 10-22 (1995)
[Medline: 95289710].

Kuramitsu,S., Ogawa,T., Ogawa,H. and Kagamiyama,H.
Branched-chain amino acid aminotransferase of Escherichia coli: nucleotide sequence of the ilvE gene and the deduced amino acid sequence.
J. Biochem. 97 (4): 993-999 (1985)
[Medline: 85289113].

Comment:
See also ilvA, NG0444; ilvC, NG1233; ilvH, NG1235; ilvI, NG1236; ilvE, NG1665.

Oklahoma ID: NGO.1665

Blast Summary:  PSI-Blast Search
Residues 1-332 in NG1665 have 98% similarity to residues 1-332 in AL162758, N. meningitidis Z2491 putative branched-chain amino acid aminotransferase.
Residues 9-328 in NG1665 have 38% similarity to residues 28-357 in
AE004019, X. fastidiosa branched-chain amino acid aminotransferase.
Residues 9-328 in NG1665 have 36% similarity to residues 29-358 in
AL031124, S. coelicolor A3(2) branched-chain amino acid aminotransferase.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0115
COG name: Branched-chain amino acid aminotransferase/4-amino-4-deoxychorismate lyase
Functional Class:  E,H
The phylogenetic pattern of COG0115 is amt-YQvCEBRhUJ------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001544 (Aminotransferases class-IV) with a combined E-value of 7.5e-38.
    IPB001544A    47-58
    IPB001544B    69-83
    IPB001544C    119-133
    IPB001544D    174-184
    IPB001544E    236-251
    IPB001544F    275-288


ProDom Summary:  Protein Domain Search
Residues 36-288 are 42% similar to a (AMINOTRANSFERASE ACID TRANSFERASE PYRIDOXAL PHOSPHATE) protein domain (PD001961) which is seen in ILVE_BACSU.



Paralogs:  Local Blast Search


NG1665 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 29 to 314 (E-value = 2.8e-70) place NG1665 in the Aminotran_4 family which is described as Aminotransferase class IV (PF01063)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
277  
293

PDB Hit:
pdb|1EKF|1EKF-A CRYSTALLOGRAPHIC STRUCTURE OF HUMAN BRANCHED 162.0 6e-41
pdb|1A3G|1A3G-A BRANCHED-CHAIN AMINO ACID AMINOTRANSFERASE FROM 100.0 4e-22
pdb|1I1K|1I1K-A CRYSTAL STRUCTURE OF ESCHELICHIA COLI 100.0 4e-22
pdb|1DAA|1DAA-A CRYS

Gene Protein Sequence:
MSRPVPAVFGSVFHSQMPVLAYREGKWQPTEWQSSQDLTLAPGAHALHYG
SECFEGLKAFRQADGKIVLFRPTANIARMRQSADILHLPRPETQAYLDAL
VELVKRAADEIPDAPAALYLRPTLIGTDPVIGKAGSPSETALLYILASPV
GDYFKVGSPVKILVETEHIRCAPHMGRVKCGGNYASAMHWLLKAKAEYGA
NQVLFCPNGDVQETGASNFILINGDEIITKPLTDEFLHGVTRDSVLTVAK
DLGYTVSERNFTVDELKAAVENGAEAILTGTAAVISPVTSFVIGGKEIEV
KNQERGYAIRKAITDIQYGLAEDKYGWLVEVC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCAGACCCGTACCCGCCGTATTCGGCAGCGTTTTTCACAGTCAAAT
GCCCGTCCTCGCCTACCGCGAAGGCAAATGGCAGCCGACCGAATGGCAAT
CTTCCCAAGACCTTACCCTTGCACCCGGCGCGCATGCCCTGCATTACGGC
AGCGAATGCTTTGAAGGTTTGAAGGCCTTCCGTCAGGCAGACGGTAAAAT
CGTGCTGTTCCGTCCGACCGCCAATATCGCGCGTATGCGGCAAAGTGCGG
ACATTTTGCACCTGCCGCGCCCCGAAACCCAAGCTTATCTCGATGCTTTG
GTCGAACTGGTCAAACGTGCCGCCGACGAAATTCCCGATGCGCCTGCCGC
GCTGTACCTGCGCCCGACCTTAATCGGTACCGATCCCGTTATCGGCAAGG
CCGGTTCTCCTTCCGAAACCGCCCTGCTGTATATTTTGGCTTCCCCCGTC
GGCGACTATTTCAAAGTCGGCTCGCCCGTGAAAATCTTGGTGGAAACCGA
ACACATCCGCTGCGCCCCGCATATGGGCCGCGTCAAATGCGGCGGCAACT
ACGCTTCCGCCATGCACTGGTTGCTGAAGGCGAAAGCCGAATACGGCGCA
AATCAAGTCCTGTTCTGCCCGAACGGCGACGTTCAGGAAACCGGCGCATC
CAACTTTATCCTGATTAACGGCGATGAAATCATTACCAAACCGTTGACAG
ACGAATTCCTGCACGGCGTTACCCGCGATTCCGTGCTGACTGTCGCCAAA
GATTTGGGCTATACCGTCAGCGAACGTAATTTCACGGTTGACGAACTGAA
AGCTGCTGTGGAAAACGGTGCGGAAGCGATTTTGACCGGTACGGCCGCCG
TCATCTCGCCCGTTACTTCCTTCGTCATCGGCGGCAAAGAAATCGAAGTG
AAAAACCAAGAACGCGGCTATGCCATCCGTAAGGCGATTACCGACATCCA
GTACGGTTTGGCGGAAGACAAATACGGCTGGCTGGTCGAAGTGTGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy