Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1353 IGR1354 IGR1357 IGR1359 IGR1352 IGR1356 IGR1358 IGR1361 IGR1360 IGR1355 bolA, - NG1657 NG1658 NG1663 gloA,lguL, - NG1661 ispA, - NG1659 fabI,envM, - NG1666 dapD, - NG1667 NG1656 NG1662 NG1664 ilvE, - NG1665 bolA, - NG1657 NG1658 NG1663 gloA,lguL, - NG1661 ispA, - NG1659 fabI,envM, - NG1666 dapD, - NG1667 NG1656 NG1662 NG1664 ilvE, - NG1665 bolA, - NG1657 NG1663 gloA,lguL, - NG1661 ispA, - NG1659 fabI,envM, - NG1666 dapD, - NG1667 NG1656 NG1662 NG1658 NG1664 ilvE, - NG1665
* Calculated from Protein Sequence

Gene ID: NG1661

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gloA  lguL  

Definition:
lactoylglutathione lyase; glyoxylase I

Gene Start:
1617263

Gene Stop:
1616877

Gene Length:
387

Molecular Weight*:
14368

pI*:
4.80

Net Charge*:
-6.38

EC:
4.4.1.5  

Functional Class:
Cellular processes; Detoxification  
Central intermediary metabolism; Pyruvate metabolism  

Pathway: pathway table
Pyruvate metabolism

Primary Evidence:
Kizil,G., Wilks,K., Wells,D. and Ala'Aldeen,D.A.
Detection and characterisation of the genes encoding glyoxalase I
and II from Neisseria meningitidis.
J. Med. Microbiol. 49 (7), 669-673 (2000)
Medline: 20337941


Secondary Evidence:
He,M.M., Clugston,S.L., Honek,J.F. and Matthews,B.W.
Determination of the structure of Escherichia coli glyoxalase I
suggests a structural basis for differential metal activation
Biochemistry 39 (30), 8719-8727 (2000)
Medline: 20374551

Clugston,S.L., Barnard,J.F., Kinach,R., Miedema,D., Ruman,R.,
Daub,E. and Honek,J.F.
Overproduction and characterization of a dimeric non-zinc
glyoxalase I from Escherichia coli: evidence for optimal activation by nickel ions
Biochemistry 37 (24), 8754-8763 (1998)
Medline: 98292407

Clugston,S.L., Daub,E., Kinach,R., Miedema,D., Barnard,J.F. and
Honek,J.F.
Isolation and sequencing of a gene coding for glyoxalase I activity from Salmonella typhimurium and comparison with other glyoxalase I sequences
Gene 186 (1), 103-111 (1997)
Medline: 97199376


Comment:
For gloB gene see NG1187.

This protein catalyzes the conversion of hemimercaptal, formed from methylglyoxal and glutathione to S-lactoylglutathione.

Oklahoma ID: NGO.1661c

Blast Summary:  PSI-Blast Search
Residues 1-125 in NG1661 have 95% similarity to residues 10-135 in AL162758, N. meningitidis Z2491 lactoylglutathione lyase.

Numerous hits in gapped BLAST to lactoylglutathione lyase sequences, e.g. residues 1-119 in NG1661 have 66% similarity to residues 10-128 in AE004773, P. aeruginosa lactoylglutathione lyase.Residues 1-122 in NG1661 have 63% similarity to residues 10-131 in S76123, Synechocystis sp. lactoylglutathione lyase.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0346
COG name: Lactoylglutathione lyase
Functional Class:  E
The phylogenetic pattern of COG0346 is A-tky--CEBRh---------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000325 (Glyoxalase I) with a combined E-value of 2.8e-40.
    IPB000325B    46-55
    IPB000325C    61-95
    IPB000325D    101-113


ProDom Summary:  Protein Domain Search
Residues 1-117 are 94% similar to a (GLYOXALASE I LYASE LACTOYLGLUTATHIONE METHYLGLYOXALASE) protein domain (PD002334) which is seen in LGUL_NEIME.

Residues 1-109 are 30% similar to a (HYPOTHETICAL 32.0 KD PROTEIN) protein domain (PD126085) which is seen in YQ5A_CAEEL.



Paralogs:  Local Blast Search


NG1661 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 114 (E-value = 1.1e-27) place NG1661 in the Glyoxalase family which is described as Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily (PF00903)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1F9Z|1F9Z-A CRYSTAL STRUCTURE OF THE NI(II)-BOUND GLYOXALASE161.0 5e-41
pdb|1FRO|1FRO-A HUMAN GLYOXALASE I WITH BENZYL-GLUTATHIONE 79.6 2e-16
pdb|1BH5|1BH5-A HUMAN GLYOXALASE I Q33E, E172Q DOUBLE MUTANT 78.4 5e-16
pdb|1F9Z|1F9Z-A CRYS

Gene Protein Sequence:
VGNLEKSLDSYQNVLGMKLLRRKDYPEGRFTLAFVGYGDETDSTVLELTH
NWDTKRYDLGDAYGHIAVEVDDAYEACERVKRQGGNVVREAGLMKHGTTV
IAFVEDPDGCKIEFVQKKSGDDSVAYANT

Gene Nucleotide Sequence:  Sequence Viewer
GTGGGCAATCTCGAAAAATCCCTCGATTCCTACCAAAACGTTTTGGGTAT
GAAACTGCTCCGCCGAAAAGACTATCCCGAAGGCAGATTTACCCTTGCCT
TCGTCGGTTACGGCGACGAAACCGACAGCACGGTTTTGGAACTGACGCAC
AACTGGGATACGAAACGATACGACTTGGGCGACGCCTACGGACACATCGC
GGTTGAAGTGGACGATGCCTACGAAGCCTGCGAACGCGTGAAGCGGCAGG
GCGGAAACGTCGTCCGCGAAGCCGGCCTGATGAAACACGGCACAACCGTG
ATAGCCTTCGTAGAAGACCCCGACGGATGCAAAATCGAGTTCGTTCAAAA
GAAAAGCGGCGACGATTCGGTTGCCTATGCGAATACC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy