Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1313.1 IGR1319 IGR1316 IGR1314 IGR1315 IGR1317 IGR1318 IGR1320 IGR1313 IGR1322 IGR1323 IGR1324 IGR1321 NG1621 NG1619 NG1624 NG1617 NG1614 NG1622 NG1623 NG1625 NG1618 NG1620 NG1616 NG1612 NG1615 NG1610.1 yadB, - NG1611 tal, - NG1610 NG1613 NG1621 NG1619 NG1624 NG1617 NG1614 NG1622 NG1623 NG1625 NG1618 NG1620 NG1616 NG1612 NG1615 NG1610.1 yadB, - NG1611 tal, - NG1610 NG1613 Type: direct, Name:  - 137 Type: direct, Name:  - 131 Type: inverse, Name:  - 148 Type: tandem, Name:  - 74 Type: inverse, Name:  - 149 Type: inverse, Name:  - 145 Type: inverse, Name:  - 139 Type: direct, Name:  - 130 NG1614 NG1622 NG1625 NG1618 NG1620 NG1616 NG1612 NG1615 NG1621 NG1619 NG1617 NG1623 NG1624 yadB, - NG1611 tal, - NG1610 NG1613 NG1610.1
* Calculated from Protein Sequence

Gene ID: NG1615

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (type I restriction enzyme related)

Gene Start:
1585758

Gene Stop:
1584613

Gene Length:
1146

Molecular Weight*:
42423

pI*:
7.30

Net Charge*:
1.48

EC:
3.1.21.3  

Functional Class:
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1615c

Blast Summary:  PSI-Blast Search
Several weak matches in gapped BLAST to type-I specific restriction enzymes. E.g. residues 75-269 are 27% similar to residues 191-410 of T1M1_ECOLI. See also TIMP_ECOLI.

No significant hits to N.meningiditis.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1615 is paralogously related to NG1131 (hypothetical protein) (2e-50), NG0465 (hypothetical protein) (8e-26) and NG0404 (type I restriction enzyme EcoR124II M protein (putative type I restriction-modification system protein)) (4e-06).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
90

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MRTHIRTCVYHDSGTKGSNTASGISGTAAGAAEQAFFSAAKTANRSASAA
SANAPPHPDKPKNGRKPMTFQGHNNRKKAGGYAEYITGGSLRRLVAAKVR
RYCGEHPGVFDGAAGSGQLEQYIEPSDFRAVEIQAEACKALLQNYPAAKV
YNTSLFLYTDGEPQDCTVMNPPFSIKLKDLSEDEKSRIAQEYPWKKSGVA
DEIFVLKGLENARRFGFFILFPGIAYRKSEQRFREIIGNRLAELNRIQNA
FEDTPIEVLLLVIDKDKTDGGCIRELYDCKTDTLLAADTWQIEPDLWQTV
QEPAPPKEKEDPVLLEHECRDAAAKRIARELRFSKMVNEIEGWPHAEFDG
FCDRLCNLIQAEKYGKKHYFPCSLPLFGGAAG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGACGCACATCCGAACCTGCGTGTATCACGATTCCGGCACAAAAGG
CTCAAACACGGCATCAGGCATAAGCGGCACGGCTGCCGGCGCGGCGGAAC
AAGCGTTTTTCAGCGCGGCGAAGACGGCAAACCGCAGCGCGTCAGCCGCA
TCCGCAAACGCTCCGCCACACCCGGACAAGCCAAAGAACGGACGAAAACC
CATGACGTTTCAAGGACACAACAACCGTAAAAAAGCCGGCGGCTACGCCG
AATACATCACGGGCGGCAGCTTGAGGCGGCTGGTTGCCGCCAAAGTCCGC
CGATACTGCGGCGAACACCCGGGCGTATTTGACGGCGCGGCAGGAAGCGG
GCAGCTGGAGCAGTACATCGAACCGTCCGATTTCCGCGCCGTAGAGATAC
AGGCGGAAGCGTGTAAAGCCTTGTTGCAAAACTACCCTGCCGCCAAAGTA
TACAACACAAGCCTTTTCCTTTATACCGACGGCGAACCGCAAGACTGCAC
CGTCATGAATCCGCCGTTTTCCATCAAGCTAAAGGATTTGAGCGAAGACG
AAAAAAGCCGTATCGCACAGGAATACCCGTGGAAGAAATCGGGCGTAGCC
GATGAAATCTTCGTTTTAAAAGGATTGGAAAACGCCCGCCGCTTCGGATT
CTTCATCCTGTTCCCCGGCATCGCCTACCGCAAAAGCGAGCAGCGATTCC
GCGAAATCATCGGCAACCGGCTGGCAGAACTCAACCGCATACAAAACGCG
TTTGAAGACACGCCGATCGAAGTGCTTTTACTGGTTATCGACAAAGACAA
AACCGACGGCGGCTGCATCCGCGAACTGTACGACTGCAAAACAGACACCC
TGCTTGCCGCCGACACTTGGCAAATCGAACCGGACTTGTGGCAAACCGTG
CAAGAACCTGCACCGCCGAAGGAAAAGGAAGACCCCGTCCTCTTGGAACA
CGAATGCCGTGACGCAGCGGCAAAGCGGATTGCCCGGGAATTGAGGTTCA
GCAAAATGGTCAACGAGATAGAAGGCTGGCCGCATGCCGAATTTGACGGC
TTTTGCGACCGCCTGTGCAACCTGATACAGGCAGAGAAATACGGAAAAAA
ACACTACTTCCCGTGCAGCCTGCCACTTTTCGGAGGGGCGGCCGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy