Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1312 IGR1313.1 IGR1311 IGR1316 IGR1310 IGR1314 IGR1315 IGR1317 IGR1313 NG1614 NG1608 NG1607 yhbG, - NG1605 NG1616 NG1612 kpsF, - NG1609 NG1615 NG1610.1 yadB, - NG1611 tal, - NG1610 NG1613 NG1614 NG1608 NG1607 yhbG, - NG1605 NG1616 NG1612 kpsF, - NG1609 NG1615 NG1610.1 yadB, - NG1611 tal, - NG1610 NG1613 Type: inverse, Name:  - 139 NG1614 NG1616 NG1612 kpsF, - NG1609 NG1615 NG1606 NG1607 yhbG, - NG1605 NG1606 NG1608 NG1610.1 yadB, - NG1611 tal, - NG1610 NG1613
* Calculated from Protein Sequence

Gene ID: NG1611

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yadB  

Definition:
glutaminyl-tRNA synthetase

Gene Start:
1580939

Gene Stop:
1581823

Gene Length:
885

Molecular Weight*:
33270

pI*:
8.90

Net Charge*:
5.98

EC:
6.1.1.17  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Gagnon,Y., Breton,R., Putzer,H., Pelchat,M., Grunberg-Manago,M. and Lapointe,J.
Clustering and co-transcription of the Bacillus subtilis genes
encoding the aminoacyl-tRNA synthetases specific for glutamate and
for cysteine and the first enzyme for cysteine biosynthesis
J. Biol. Chem. 269 (10), 7473-7482 (1994)
Medline: 94171772

Breton,R., Watson,D., Yaguchi,M. and Lapointe,J.
Glutamyl-tRNA synthetases of Bacillus subtilis 168T and of Bacillus stearothermophilus. Cloning and sequencing of the gltX genes and comparison with other aminoacyl-tRNA synthetases
J. Biol. Chem. 265 (30), 18248-18255 (1990)
Medline: 91009314


Comment:
Oklahoma ID: NGO.1611

Blast Summary:  PSI-Blast Search
Residues 1-295 are 95% similar to glutamyl-tRNA synthetase-related protein in Neisseria meningitidis group B strain MD58 (11353157).

Numerous hits in gapped BLAST to glutamyl-tRNA synthetase-related protein sequences,e.g.residues 2-291 are 47% similar to a probable aminoacyl-transfer RNA synthetase in Pseudomonas aeruginosa strain PAO1 (11350971|).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 2-292 are 46% similar to a (SYNTHETASE GLUTAMYL-TRNA PROTEIN AMINOACYL-TRNA LIGASE) protein domain (PD001595) which is seen in YADB_ECOLI.



Paralogs:  Local Blast Search


NG1611 is paralogously related to NG1926 (glutamyl-tRNA synthetase (GltX)) (8e-37) and NG1218 (glutaminyl-tRNA synthetase) (2e-05).


Pfam Summary:  Pfam Search
Residues 1 to 276 (E-value = 2.9e-26) place NG1611 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1G59|1G59-A GLUTAMYL-TRNA SYNTHETASE COMPLEXED WITH 127.0 3e-30
pdb|1EUQ|1EUQ-A CRYSTAL STRUCTURE OF GLUTAMINYL-TRNA SYNTHETASE 50.0 6e-07
pdb|1QRU|1QRU-A GLUTAMINYL-TRNA SYNTHETASE MUTANT I129T 50.0 6e-07
pdb|1GSG|1GSG-P GLUT

Gene Protein Sequence:
MYTGRFAPSPTGLLHIGSLLTAVASYADARSNGGKWLVRMEDLDPPREMP
GAASHILHTLEAFGFKWDGEVTYQSRRYALYEETLYRLKTAGLVYPCHCN
RKDWQAGARRGTDGFVYNGRCRHPGQRPALQGKQPSWRIRVPDRDIGFSD
GIVGSYAQNLARDIGDFVLFRADGYWAYQLAVVADDAEQGVTHIVRGQDL
LVSTPRQIYLQQCLGVPTPQYAHLPLLTNAQGQKWSKQTLAPALDLNRRE
QLLRQVFRYLKLPEAPETDRPAELLDWAVAHWDMDKVPKHAITAP

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACACAGGACGCTTCGCCCCCAGCCCGACCGGGTTGCTCCACATCGG
CTCTCTGCTGACCGCCGTCGCTTCCTATGCCGATGCACGTTCAAACGGCG
GCAAATGGCTGGTCCGTATGGAAGACCTCGATCCGCCGCGCGAAATGCCG
GGGGCGGCAAGCCATATCCTGCACACGCTCGAGGCATTCGGATTCAAGTG
GGACGGCGAAGTCACCTATCAGAGCCGCCGTTACGCCCTGTATGAAGAAA
CCCTATACCGTCTGAAAACCGCCGGACTGGTCTATCCCTGCCATTGCAAC
CGCAAAGACTGGCAGGCCGGGGCAAGGCGGGGCACAGACGGGTTCGTCTA
TAACGGACGCTGCCGCCACCCCGGCCAACGCCCTGCACTGCAAGGCAAAC
AGCCGTCGTGGCGCATCCGCGTCCCCGACCGCGACATCGGCTTTTCAGAC
GGCATCGTCGGCAGTTACGCCCAAAACCTCGCCCGCGACATCGGCGATTT
CGTCCTGTTCCGTGCAGACGGTTACTGGGCATACCAGCTCGCCGTCGTTG
CCGACGATGCCGAACAGGGCGTTACCCACATCGTGCGCGGACAAGACCTG
CTCGTTTCCACACCGCGCCAAATCTATTTGCAGCAGTGTTTGGGCGTTCC
GACACCGCAATATGCCCACCTGCCGCTGCTGACCAACGCGCAAGGGCAGA
AATGGTCGAAGCAGACGCTCGCCCCCGCATTGGATTTAAACCGCCGCGAA
CAACTTCTCCGCCAAGTGTTCCGCTACCTCAAGCTGCCCGAAGCACCGGA
AACCGACCGCCCTGCCGAATTGCTCGACTGGGCGGTGGCACACTGGGATA
TGGACAAAGTGCCGAAACACGCCATTACCGCCCCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy