Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 IGR1307 IGR1308 IGR1312 IGR1311 IGR1310 IGR1304 IGR1305 IGR1306 IGR1309 NG1598 NG1608 NG1607 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 mtgA, - NG1603 aroE, - NG1602 tal, - NG1610 NG1601 NG1598 NG1608 NG1607 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 mtgA, - NG1603 aroE, - NG1602 tal, - NG1610 NG1601 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1606 NG1607 NG1598 NG1606 NG1608 mtgA, - NG1603 aroE, - NG1602 tal, - NG1610 NG1601 NG1604
* Calculated from Protein Sequence

Gene ID: NG1603

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mtgA  

Definition:
monofunctional peptidoglycan transglycosylase (MtgA)

Gene Start:
1574618

Gene Stop:
1575316

Gene Length:
699

Molecular Weight*:
26628

pI*:
10.60

Net Charge*:
11.96

EC:
2.4.2.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Histidine metabolism

Primary Evidence:
Zhou,J., Bowler,L.D. and Spratt,B.G.
Interspecies recombination, and phylogenetic distortions, within
the glutamine synthetase and shikimate dehydrogenase genes of
Neisseria meningitidis and commensal Neisseria species
Mol. Microbiol. 23 (4), 799-812 (1997)
Medline: 97206157

Spratt,B.G., Zhou,J., Taylor,M. and Merrick,M.J.
Monofunctional biosynthetic peptidoglycan transglycosylases
Mol. Microbiol. 19 (3), 639-640 (1996)
Medline: 96228711


Comment:
Oklahoma ID: NGO.1603

Blast Summary:  PSI-Blast Search
NG1603 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1196663.

Residues 1-233 have 94% similarity to residues 1-233 in AL162758, N. meningitidis Z2491 monofunctional biosynthetic peptidoglycan transglycosylase.

Numerous hits in gapped BLAST to monofunctional biosynthetic peptidoglycan transglycosylase sequences e.g.residues 1-228 have 39% similarity to residues 1-224 in Z46863, Acinetobacter sp. ADP1 monofunctional biosynthetic peptidoglycan transglycosylase.



COGS Summary:  COGS Search
BeTs to 10 clades of COG0744
COG name: Membrane carboxypeptidase (penicillin-binding protein)
Functional Class:  M
The phylogenetic pattern of COG0744 is -----qvCEBRHuj--ol--x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001264 (Glycosyltransferase family 51) with a combined E-value of 5e-56.
    IPB001264A    62-101
    IPB001264B    110-162
    IPB001264C    167-193


ProDom Summary:  Protein Domain Search
Residues 208-233 are identical to a (MONOFUNCTIONAL BIOSYNTHETIC PEPTIDOGLYCAN) protein domain (PD159842) which is seen in MTGA_NEIGO.

Residues 61-207 are identical to a (PROTEIN PENICILLIN-BINDING PEPTIDOGLYCAN) protein domain (PD001895) which is seen in MTGA_NEIGO.

Residues 1-60 are identical to a (MONOFUNCTIONAL BIOSYNTHETIC PEPTIDOGLYCAN) protein domain (PD082049) which is seen in MTGA_NEIGO.



Paralogs:  Local Blast Search


NG1603 is paralogously related to NG0099 (penicillin-binding protein 1) (2e-21).


Pfam Summary:  Pfam Search
Residues 41 to 208 (E-value = 4.2e-81) place NG1603 in the Transgly family which is described as Transglycosylase (PF00912)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
25

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFRIVKWLIALPVGIFIFFNAYVYGNIITYRAVAPHRTAFMSMRMKQFEQ
EGRDVALDYRWVPYNRISTNLKKALIASEDVRFAGHGGFDWDGIQNAIRR
NRNSGEVKAGGSTISQQLAKNLFLNESRNYLRKGEEAAITAMMEAVTDKN
RIFELYLNSIEWHYGVFGAEAASRYFYKKPAADLTKQQAAKLTALVPAPL
YYADHPKSKRLRNKTNIVLRRMGSAELPESDTD

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCCGCATCGTCAAATGGCTGATTGCCCTGCCCGTCGGCATCTTTAT
CTTTTTCAATGCCTATGTGTACGGCAACATCATCACCTACCGCGCCGTCG
CGCCCCATCGGACTGCCTTTATGTCGATGCGGATGAAGCAGTTTGAACAA
GAAGGTCGCGATGTCGCACTGGATTACCGCTGGGTGCCCTACAACCGCAT
TTCCACCAACCTGAAAAAAGCCCTGATTGCTTCCGAAGATGTCCGTTTTG
CCGGACACGGCGGCTTCGATTGGGACGGCATTCAAAACGCCATCAGGCGC
AACCGGAACAGCGGCGAAGTGAAGGCGGGCGGATCGACCATCAGCCAGCA
GCTTGCCAAAAACCTCTTCCTCAACGAAAGCCGCAACTATCTGCGCAAAG
GGGAAGAGGCGGCCATTACGGCAATGATGGAAGCTGTTACCGACAAAAAC
AGGATTTTCGAACTGTATTTAAACTCAATCGAATGGCACTACGGCGTTTT
CGGCGCGGAAGCTGCGTCCCGGTATTTTTATAAAAAACCGGCCGCAGACC
TGACCAAACAGCAGGCGGCGAAACTGACGGCACTCGTCCCCGCCCCGCTC
TACTACGCTGACCATCCGAAAAGCAAACGGCTGCGCAACAAAACCAATAT
CGTGCTCAGACGCATGGGTTCGGCAGAATTACCCGAAAGCGATACGGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy