Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 IGR1307 IGR1308 IGR1311 IGR1310 IGR1304 IGR1305 IGR1306 IGR1309 NG1598 NG1608 NG1607 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1598 NG1608 NG1607 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1598 yhbG, - NG1605 kpsF, - NG1609 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1606 NG1607 NG1606 NG1608 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1604
* Calculated from Protein Sequence

Gene ID: NG1602

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aroE  

Definition:
shikimate dehydrogenase (AroE)

Gene Start:
1573776

Gene Stop:
1574612

Gene Length:
837

Molecular Weight*:
29778

pI*:
7.60

Net Charge*:
1.54

EC:
1.1.1.25  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Primary Evidence:
Zhou,J., Bowler,L.D. and Spratt,B.G.
Interspecies recombination, and phylogenetic distortions, within
the glutamine synthetase and shikimate dehydrogenase genes of
Neisseria meningitidis and commensal Neisseria species
Mol. Microbiol. 23 (4), 799-812 (1997)
Medline: 97206157


Secondary Evidence:
Maclean,J., Campbell,S.A., Pollock,K., Chackrewarthy,S.,
Coggins,J.R. and Lapthorn,A.J.
Crystallization and preliminary X-ray analysis of shikimate
dehydrogenase from Escherichia coli
Acta Crystallogr. D 56, 512-515 (2000)

Anton,I.A. and Coggins,J.R.
Sequencing and overexpression of the Escherichia coli aroE gene
encoding shikimate dehydrogenase
The Biochemical journal. 249 (2), 319-326 (1988)
Medline: 88134021


Comment:
For other 'aro' genes,see NG0092 (aroB), NG0740 (aroD), NG0093
(aroK), NG900(aroA), NG1331 (aroC),NG1695 (aroG).

Oklahoma ID: NGO.1602

Blast Summary:  PSI-Blast Search
NG1602 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 1785896.

Residues 11-279 in NG1602 have 92% similarity to residues 1-269 in U82834, N. meningitidis shikimate dehydrogenase.

Numerous hits in gapped BLAST to shikimate dehydrogenase sequences,e.g.residues 17-277 in NG1602 have 52% similarity to residues 4-267 in Y00710, E. coli shikimate dehydrogenase.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0169
COG name: Shikimate 5-dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0169 is amt-yqvcEbrHuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002907 (Shikimate / quinate 5-dehydrogenase) with a combined E-value of 4.4e-69.
    IPB002907A    19-46
    IPB002907B    70-101
    IPB002907C    109-118
    IPB002907D    137-146
    IPB002907E    189-202
    IPB002907F    247-262


ProDom Summary:  Protein Domain Search
Residues 222-277 are identical to a (SHIKIMATE DEHYDROGENASE 5-DEHYDROGENASE OXIDOREDUCTASE) protein domain (PD149680) which is seen in P95365_NEIGO.

Residues 133-217 are 90% similar to a (OXIDOREDUCTASE BIOSYNTHESIS NADP REDUCTASE GLUTAMYL-TRNA) protein domain (PD001191) which is seen in P95365_NEIGO.

Residues 32-118 are identical to a (SHIKIMATE 5-DEHYDROGENASE DEHYDROGENASE OXIDOREDUCTASE) protein domain (PD120824) which is seen in P95361_NEIGO.



Paralogs:  Local Blast Search


NG1602 is paralogously related to NG1403 (glutamyl-tRNA reductase (HemA)) (2e-04).


Pfam Summary:  Pfam Search
Residues 32 to 265 (E-value = 1.2e-103) place NG1602 in the Shikimate_DH family which is described as Shikimate / quinate 5-dehydrogenase (PF01488)
Residues 121 to 238 (E-value = 5.9e-05) place NG1602 in the GlutR_NAD_bind family which is described as Glutamyl-tRNAGlu reductase, NAD(P) binding domain (PF05200)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
79  
206
transmembrane  
136  
152

PDB Hit:
pdb|1NPD|1NPD-A X-RAY STRUCTURE OF SHIKIMATE DEHYDROGENASE 80.4 4e-16

Gene Protein Sequence:
MTAPPLWNMTMHALPRYAVFGNPAAHSKSPQIHQQFALQEGVDIEYGRIC
ADIGGFAQAVSTFFETGGCGANVTVPFKQEAFHLADEHSDRALAAGAVNT
LVWLEDGRIRGDNTDGIGLANDITQVKNIAIEGKTILLLGAGGAVRGVIP
VLKEHRPARIVIANRTRAKAEELARLFGIEAVPMADVNGGFDIIINGTSG
GLSGQLPAVSPKIFRDCRLAYDMVYGEAAKPFLDFARQSGAKKTADGLGM
LVGQAAASYALWRGFKPDIRPVIEHMKAL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGCCCCGCCTTTATGGAATATGACTATGCACGCCCTCCCCCGCTA
CGCCGTTTTCGGCAACCCCGCCGCCCACAGCAAATCGCCGCAGATTCATC
AGCAATTTGCCCTTCAGGAAGGCGTTGACATCGAATACGGACGCATTTGC
GCCGACATCGGCGGTTTCGCGCAGGCGGTTTCGACATTTTTTGAAACAGG
CGGTTGCGGGGCAAACGTTACCGTACCGTTCAAACAGGAAGCGTTTCATC
TGGCGGACGAACATTCCGACCGCGCTTTGGCTGCCGGTGCGGTCAATACG
CTGGTGTGGTTGGAAGACGGCAGAATACGCGGCGACAATACCGACGGTAT
CGGTTTGGCCAACGACATCACGCAGGTCAAAAACATTGCCATCGAGGGCA
AAACCATCTTGCTTTTGGGCGCGGGCGGCGCGGTGCGCGGCGTGATTCCG
GTTTTGAAAGAACACCGCCCTGCCCGTATCGTCATTGCCAACCGTACCCG
CGCCAAAGCCGAGGAATTGGCGCGGCTTTTCGGCATTGAAGCCGTCCCGA
TGGCGGATGTGAACGGCGGTTTCGATATCATCATCAACGGCACGTCCGGC
GGCTTGAGCGGTCAGCTTCCTGCCGTCAGCCCTAAAATTTTCCGCGACTG
CCGCCTTGCCTACGATATGGTTTACGGCGAAGCGGCAAAACCGTTTTTAG
ATTTTGCACGACAATCGGGTGCGAAAAAAACTGCCGACGGACTGGGTATG
CTAGTCGGTCAGGCGGCGGCTTCCTACGCCCTCTGGCGCGGTTTCAAACC
GGACATCCGCCCCGTCATCGAACACATGAAAGCCCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy