Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Phe-1 IGR1307 IGR1308 IGR1302.1 IGR1310 IGR1304 IGR1305 IGR1306 IGR1309 IGR1303 NG1598 NG1608 NG1607 yhbG, - NG1605 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 NG1595.1 NG1596 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1598 NG1608 NG1607 yhbG, - NG1605 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1604 NG1595.1 NG1596 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1598 yhbG, - NG1605 ampG,yajG, - NG1599 glnA, - NG1600 NG1597 NG1606 NG1607 NG1608 NG1606 NG1596 mtgA, - NG1603 aroE, - NG1602 NG1601 NG1604 NG1595.1
* Calculated from Protein Sequence

Gene ID: NG1600

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnA  

Definition:
glutamine synthetase (GlnA)

Gene Start:
1573495

Gene Stop:
1572080

Gene Length:
1416

Molecular Weight*:
51994

pI*:
5.10

Net Charge*:
-16.49

EC:
6.3.1.2  

Functional Class:
Amino acid biosynthesis; Glutamate family/nitrogen assimilation  

Pathway: pathway table
Glutamate metabolism
Nitrogen metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Miranda-Rios,J., Sanchez-Pescador,R., Urdea,M. and Covarrubias,A.A.
The complete nucleotide sequence of the glnALG operon of
Escherichia coli K12
Nucleic Acids Res. 15 (6), 2757-2770 (1987)
M:87174797

Colombo,G. and Villafranca,J.J.
Amino acid sequence of Escherichia coli glutamine synthetase
deduced from the DNA nucleotide sequence
J. Biol. Chem. 261 (23), 10587-10591 (1986)
M:86278128

Covarrubias,A.A. and Bastarrachea,F.
Nucleotide sequence of the glnA control region of Escherichia coli
Mol. Gen. Genet. 190 (1), 171-175 (1983)
M:83218556

Reitzer,L.J. and Magasanik,B.
Expression of glnA in Escherichia coli is regulated at tandem
promoters
Proc. Natl. Acad. Sci. U.S.A. 82 (7), 1979-1983 (1985)
M:85166256

Ueno-Nishio,S., Mango,S., Reitzer,L.J. and Magasanik,B.
Identification and regulation of the glnL operator-promoter of the
complex glnALG operon of Escherichia coli
J. Bacteriol. 160 (1), 379-384 (1984)
M:85006814

Rocha,M., Vazquez,M., Garciarrubio,A. and Covarrubias,A.A.
Nucleotide sequence of the glnA-glnL intercistronic region of
Escherichia coli
Gene 37 (1-3), 91-99 (1985)
M: 86031370


Comment:
Oklahoma ID: NGO.1600c

For other 'gln' genes, see NG0269 (glnQ), NG0374 (glnQ), NG0798 (glnD), NG1182 (glnB), NG1218 (glnS), NG2011 (glnM), NG1758
(glnE), NG2013 (glnQ), NG2012 (glnP).

Blast Summary:  PSI-Blast Search
NG1600 is 98% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 150353.
Residues 1-472 in NG1600 have 98% similarity to residues 1-472 in AL162758, N. meningitidis Z2491 glutamine synthetase.
Residues 7-472 in NG1600 have 68% similarity to residues 9-471 in AF082873, H. seropedicae glutamine synthetase.


COGS Summary:  COGS Search
BeTs to 13 clades of COG0174
COG name: Glutamine synthase
Functional Class:  E
The phylogenetic pattern of COG0174 is amtkyqvCEbRhuj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001637 (Glutamine synthetase class-I adenylation site) with a combined E-value of 1.6e-243.
    IPB001637A    4-35
    IPB001637B    47-83
    IPB001637C    112-144
    IPB001637D    171-222
    IPB001637E    242-289
    IPB001637F    291-321
    IPB001637G    322-350
    IPB001637H    354-407
    IPB001637I    461-471
***** IPB001691 (Glutamine synthetase) with a combined E-value of 1.1e-65.
    IPB001691A    51-63
    IPB001691B    129-138
    IPB001691C    174-185
    IPB001691D    192-239
    IPB001691E    268-277
    IPB001691F    282-298
    IPB001691G    359-372


ProDom Summary:  Protein Domain Search
Residues 302-428 are 93% similar to a (LIGASE GLUTAMINE SYNTHETASE) protein domain (PD001057) which is seen in GLNA_NEIGO.

Residues 1-301 are 94% similar to a (LIGASE SYNTHETASE GLUTAMINE GLUTAMATE--AMMONIA NITROGEN) protein domain (PD000349) which is seen in GLNA_NEIGO.

Residues 435-471 are identical to a (LIGASE GLUTAMINE SYNTHETASE) protein domain (PD186107) which is seen in GLNA_NEIGO.



Paralogs:  Local Blast Search


NG1600 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 14 to 99 (E-value = 2.1e-41) place NG1600 in the Gln-synt_N family which is described as Glutamine synthetase, beta-Grasp domain (PF03951)
Residues 105 to 386 (E-value = 7.7e-166) place NG1600 in the Gln-synt_C family which is described as Glutamine synthetase, catalytic domain (PF00120)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|2GLS|2GLS-A REFINED ATOMIC MODEL OF GLUTAMINE SYNTHETASE AT 594.0 0e+00
pdb|1F1H|1F1H-A CRYSTAL STRUCTURE OF GLUTAMINE SYNTHETASE FROM 592.0 0e+00
pdb|1HTO|1HTO-A CRYSTALLOGRAPHIC STRUCTURE OF A RELAXED 449.0 0e+00
pdb|2GLS|2GLS-A REFI

Gene Protein Sequence:
MSIKNAVKLIEESEARFVDLRFTDTKGKQHHFTVPARIVLEDPEEWFENG
PAFDGSSIGGWKGIEASDMQLRPDASTAFVDPFYDDVTVVITCDVIDPAD
GQGYDRDPRSIARRAEAYLKSSGIGDTAYFGPEPEFFVFDGVEFETDMHK
TRYEITSESGAWASGLHMDGQNTGHRPAVKGGYAPVAPIDCGQDLRSAMV
NILEGLGIEVEVHHSEVGTGSQMEIGTRFATLVKRADQTQDMKYVIQNVA
HNFGKTATFMPKPIMGDNGSGMHVHQSIWKDGQNLFAGDGYAGLSDTALY
YIGGIIKHAKALNAITNPSTNSYKRLVPHFEAPTKLAYSAKNRSASIRIP
SVNSSKARRIEARFPDPTANPYLAFAALLMAGLDGIQNKIHPGDPADKNL
YDLPPEEDALVPTVCASLEEALAALKADHEFLLRGGVFSKDWIDSYIAFK
EEDVRRIRMAPHPLEFEMYYSL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCATTAAAAACGCCGTAAAATTGATTGAAGAAAGCGAAGCCCGCTT
TGTCGATTTGCGCTTCACCGATACCAAAGGCAAGCAGCACCACTTTACCG
TGCCTGCGCGCATCGTGTTGGAAGACCCCGAAGAGTGGTTTGAAAACGGA
CCGGCGTTTGACGGCTCGTCCATCGGCGGCTGGAAAGGCATTGAGGCTTC
CGATATGCAGTTGCGCCCCGATGCGTCCACAGCCTTCGTCGATCCTTTTT
ATGATGATGTTACCGTCGTCATTACCTGCGACGTCATCGACCCTGCCGAC
GGTCAGGGTTACGACCGCGACCCGCGCTCCATCGCACGTCGCGCCGAAGC
CTATTTGAAATCTTCCGGTATCGGCGACACCGCCTATTTCGGCCCCGAAC
CCGAATTCTTCGTCTTCGACGGCGTAGAATTTGAAACCGACATGCACAAA
ACCCGTTACGAAATCACGTCCGAAAGCGGCGCGTGGGCAAGCGGCCTGCA
TATGGACGGTCAAAACACCGGCCACCGCCCCGCCGTCAAAGGCGGCTACG
CGCCCGTCGCGCCGATTGACTGCGGTCAAGATTTGCGCTCCGCCATGGTG
AACATTTTGGAAGGACTCGGCATCGAAGTCGAAGTCCACCACAGCGAAGT
CGGTACCGGCAGCCAAATGGAAATCGGCACCCGTTTCGCCACTTTGGTCA
AACGCGCCGACCAAACCCAAGATATGAAATACGTCATCCAAAACGTTGCC
CACAATTTCGGCAAAACCGCCACCTTTATGCCCAAACCGATTATGGGCGA
CAACGGCAGCGGTATGCACGTCCACCAATCCATTTGGAAAGACGGTCAAA
ACCTGTTCGCAGGCGACGGCTATGCCGGTTTGTCCGATACCGCGCTCTAC
TACATCGGCGGCATCATCAAACACGCCAAAGCCCTGAACGCGATTACCAA
TCCGTCCACCAACTCCTACAAACGCCTCGTGCCGCACTTTGAAGCACCGA
CCAAATTGGCCTATTCCGCCAAAAACCGTTCCGCTTCCATCCGTATCCCG
TCTGTGAACAGCAGCAAGGCGCGCCGCATCGAAGCGCGTTTCCCCGACCC
GACCGCCAACCCGTATTTGGCATTTGCCGCCCTGCTGATGGCCGGTTTGG
ACGGCATTCAAAACAAAATCCATCCGGGCGACCCTGCCGATAAAAACCTG
TACGACCTGCCGCCGGAAGAAGACGCGCTCGTCCCGACCGTCTGCGCTTC
TTTGGAAGAAGCACTTGCCGCCCTCAAGGCCGACCACGAATTCCTGCTGC
GCGGCGGCGTGTTCAGCAAAGACTGGATCGACAGCTACATCGCCTTTAAA
GAGGAAGATGTCCGCCGCATCCGTATGGCGCCGCACCCGCTGGAATTTGA
AATGTATTACAGCCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy