Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1290 IGR1284 IGR1285 IGR1291 IGR1287 IGR1292 IGR1288 IGR1289 IGR1284.1 IGR1286 NG1575.1 omp3, - NG1577 NG1579 thiL, - NG1575 pitB, - NG1581 NG1576 NG1582 mafA2, - NG1584 cysB, - NG1578 NG1583 hemN, - NG1580 NG1575.1 omp3, - NG1577 NG1579 thiL, - NG1575 pitB, - NG1581 NG1576 NG1582 mafA2, - NG1584 cysB, - NG1578 NG1583 hemN, - NG1580 Type: inverse, Name:  - 138 omp3, - NG1577 NG1579 thiL, - NG1575 pitB, - NG1581 NG1575.1 NG1576 NG1582 mafA2, - NG1584 cysB, - NG1578 NG1583 hemN, - NG1580
* Calculated from Protein Sequence

Gene ID: NG1580

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemN  

Definition:
oxygen-independent coproporphyrinogen III oxidase (HemN)

Gene Start:
1554532

Gene Stop:
1555950

Gene Length:
1419

Molecular Weight*:
54273

pI*:
6.70

Net Charge*:
-2.44

EC:
1.3.3.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Heme, porphyrin, and cobalamin  

Pathway: pathway table
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Troup,B., Hungerer,C. and Jahn,D.
Cloning and characterization of the Escherichia coli hemN gene
encoding the oxygen-independent coproporphyrinogen III oxidase
J. Bacteriol. 177 (11), 3326-3331 (1995)
Medline: 95286520


Comment:
Oklahoma ID: NGO.1580

For other 'hem' genes, see NG0040 (hemL), NG0234 (hemN), NG0293 (hemH), NG0360 (hemX), NG0362 (hemE), NG0385 (hemB), NG1318 (hemO), NG1403 (hemA), NG2015 (hemK).

Blast Summary:  PSI-Blast Search
Residues 1-473 in NG1580 have 99% similarity to residues 1-473 in AE002394, N. meningitidis MC58 oxygen-independent coproporphyrinogen III oxidase.
Residues 21-461 in NG1580 have 55% similarity to residues 20-456 in U94742, R. eutropha oxygen-indendent coproporphyrinogen III dehydrogenase.
Residues 15-460 in NG1580 have 55% similarity to residues 3-448 in
AE004582, P. aeruginosa oxygen-independent coproporphyrinogen III oxidase.



COGS Summary:  COGS Search
BeTs to 11 clades of COG0635
COG name: Coproporphyrinogen III oxidase and related FeS oxidoreductases
Functional Class:  H
The phylogenetic pattern of COG0635 is -----QvCEBrhUJ--olINx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003401 (Oxygen-independent coproporphyrinogen III oxidase) with a combined E-value of 4.7e-148.
    IPB003401A    32-40
    IPB003401B    69-84
    IPB003401C    121-134
    IPB003401D    157-202
    IPB003401E    218-262
    IPB003401F    305-345
    IPB003401G    375-396
    IPB003401H    450-459


ProDom Summary:  Protein Domain Search
Residues 68-302 are 59% similar to a (PROTEIN BIOSYNTHESIS OXIDASE COPROPORPHYRINOGEN III) protein domain (PD000690) which is seen in HEMN_ALCEU.

Residues 298-341 are 65% similar to a (OXIDASE COPROPORPHYRINOGEN III PORPHYRIN) protein domain (PD004921) which is seen in YANB_PSEAE.

Residues 343-424 are 42% similar to a (OXIDASE COPROPORPHYRINOGEN III PORPHYRIN) protein domain (PD005289) which is seen in HEMN_AQUAE.



Paralogs:  Local Blast Search


NG1580 is paralogously related to NG0234 (oxygen-independent coprophorphyrinogen III oxidase family protein (putative porphyrin oxidoreductase)) (1e-29).


Pfam Summary:  Pfam Search
Residues 71 to 245 (E-value = 1.4e-28) place NG1580 in the Radical_SAM family which is described as Radical SAM superfamily (PF04055)
Residues 327 to 447 (E-value = 1.8e-53) place NG1580 in the HemN_C family which is described as HemN C-terminal region (PF06969)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKIIQIQNNHNVNDDRPEFDRALIASLPASGPRYTSYPTADRFHDGFREG
EYIKVLHLRGMGALNKPLSLYIHIPFCNTICYYCGCNKIITKDKSRADTY
IEYLEKEMELLAPHLNGRHQLAQLHFGGGTPTFLSDEQIERVFRMIRKHF
ELIPSGEYSIEIDPRKVSRDTVLMLGRLGFNRMSVGIQDFDPKVQAAVNR
IQSYEETKEVIDAAREAGFKSVSVDLIYGLPHQTSESIKTTIDTVLSLDP
DRLALYHYAHLPHVFKPQRRIDTAAVPDSEEKLDMLQYCVQTLTERGYVF
IGMDHFAKPDDELSIALKEGFLQRNFQGYSTYADCDLVAIGVSSIGKIGS
TYSQNERDIDAYYAAIDEGRLPIMRGYQLNQDDILRRNIIQDLMCRFALD
YRIYESMFGIPFDRYFKDELADLEKLAGLGLVRLNSHGLTVTPKGRFLIR
NIAMVFDYHLRHKETKAKYSQTV

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCATTCAGATACAGAACAATCACAATGTAAACGATGACCGCCC
CGAGTTTGACCGCGCGCTGATTGCCAGCCTGCCCGCCAGCGGCCCGCGCT
ATACTTCCTACCCTACCGCCGACCGTTTCCATGACGGTTTCCGCGAAGGC
GAATATATCAAAGTTTTACATTTGCGCGGTATGGGCGCGTTAAACAAACC
GCTTTCCCTTTACATTCACATTCCGTTTTGCAACACCATCTGCTACTACT
GCGGCTGCAACAAAATCATCACCAAAGACAAAAGCCGCGCCGATACCTAC
ATCGAATATCTTGAAAAAGAAATGGAACTGCTCGCTCCACATCTGAACGG
ACGGCACCAGCTTGCCCAACTGCACTTCGGCGGCGGCACGCCGACCTTTT
TGAGCGACGAACAGATCGAACGTGTCTTCCGCATGATCCGCAAACATTTC
GAACTGATACCGTCCGGCGAATATTCCATCGAAATCGACCCGCGCAAAGT
CAGCCGCGACACCGTCCTCATGCTCGGCAGACTCGGCTTCAACCGCATGA
GCGTCGGCATTCAGGATTTCGACCCCAAAGTGCAGGCGGCAGTCAACCGC
ATCCAAAGCTACGAAGAAACCAAAGAAGTCATCGATGCCGCCCGTGAGGC
AGGGTTCAAATCCGTCAGCGTCGATTTGATTTACGGCTTGCCGCATCAGA
CTTCCGAAAGCATCAAAACCACCATAGATACCGTTTTGTCGCTCGATCCC
GACCGCCTCGCCCTTTACCACTACGCCCACCTGCCGCACGTGTTCAAACC
GCAACGCCGCATCGATACCGCCGCCGTCCCCGACAGCGAAGAGAAGCTCG
ATATGCTGCAATACTGCGTCCAAACCCTGACAGAGCGCGGCTACGTCTTC
ATCGGCATGGACCATTTCGCCAAACCTGACGACGAACTCTCCATCGCCCT
CAAAGAAGGCTTCCTCCAACGCAACTTCCAAGGCTATTCGACCTACGCGG
ATTGCGATTTGGTCGCCATCGGCGTGTCGTCCATCGGCAAAATCGGCAGC
ACCTATTCCCAAAACGAACGCGACATCGATGCCTACTATGCCGCCATCGA
CGAAGGCAGACTGCCCATCATGCGCGGCTACCAGCTCAATCAGGACGACA
TCCTGCGCCGCAACATCATTCAGGATTTAATGTGCCGCTTCGCGCTCGAC
TACAGGATTTACGAAAGTATGTTCGGCATCCCGTTCGACCGCTACTTCAA
AGACGAACTGGCGGATTTGGAAAAACTCGCCGGTTTGGGATTGGTGCGCC
TGAACAGCCACGGGCTGACCGTTACACCGAAAGGACGCTTCCTCATCCGC
AACATCGCCATGGTCTTCGACTACCACCTGCGCCACAAAGAAACCAAAGC
GAAATATTCGCAAACGGTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy