Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1284 IGR1285 IGR1283 IGR1287 IGR1288 IGR1282.5 IGR1284.1 IGR1286 IGR1282.4 IGR1282.3 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 pgpA, - NG1574 pgpA, - NG1574 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573
* Calculated from Protein Sequence

Gene ID: NG1575

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
thiL  

Definition:
thiamin-monophosphate kinase

Gene Start:
1550751

Gene Stop:
1549798

Gene Length:
954

Molecular Weight*:
34355

pI*:
5.00

Net Charge*:
-7.45

EC:
2.7.4.16  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table
Thiamine metabolism

Secondary Evidence:
Webb E, Downs D.
Characterization of thiL, encoding thiamin-monophosphate kinase, in Salmonella typhimurium.
J Biol Chem. 1997 Jun 20;272(25):15702-7.
PMID: 9188462

Shikata H, Egi Y, Koyama S, Yamada K, Kawasaki T.
Properties of the thiamin triphosphate-synthesizing activity catalyzed by adenylate kinase (isoenzyme 1).
Biochem Int. 1989 May;18(5):943-9.
PMID: 2551298

Comment:
Oklahoma ID: NGO.1575c

For other 'thi' genes, see NG1160 (thiD), NG2041 (thiC), NG2005 (thiG), NG2007 (thiE), NG2008 (thiO), NG2019 (thiF).

Blast Summary:  PSI-Blast Search
Residues 1-318 in NG1575 have 99% similarity to residues 1-318 in AL162758, N. meningitidis Z2491 thiamine-monophosphate kinase.
Residues 1-317 in NG1575 have 46% similarity to residues 1-322 in AE003934, X. fastidiosa thiamine-monophosphate kinase.
Residues 1-317 in NG1575 have 43% similarity to residues 20-341 in U32810, H. influenzae Rd thiamin-monophosphate kinase (thiL).


COGS Summary:  COGS Search
BeTs to 9 clades of COG0611
COG name: Thiamine monophosphate kinase
Functional Class:  H
The phylogenetic pattern of COG0611 is amtk-q-cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-117 are 46% similar to a (PROTEIN LIGASE SYNTHETASE) protein domain (PD000644) which is seen in THIL_HAEIN.

Residues 130-317 are 40% similar to a (PROTEIN HYDROGENASE EXPRESSION/FORMATION) protein domain (PD002206) which is seen in THIL_SALTY.



Paralogs:  Local Blast Search


NG1575 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 135 (E-value = 8.2e-05) place NG1575 in the AIRS family which is described as AIR synthase related protein, N-terminal domain (PF00586)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
158  
259

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKEFDFIKRYLQTGTDKDVVLGIGDDAAIVRPREGFDLCFSADMLLKDRH
FFADVKPEGLAWKVLAVNISDMAAMGAIPRWVLLSAALPELDEVWLERFC
GSFFGLAKKFGVTLIGGDTTKGDMAFNVTIIGELPKGRALRRDAAVAGDD
IWVSGRVGMAAAALNCRLKRCVLPDDVFAECEQKLLRPEPRVGLGLALLP
FARAAQDVSDGLAQDLGHILTASGVGAEIWADSLPSLSVLKDILPRAQWL
SYTLAGGDDYELVFTAPESCRSRVLDAAERCGVPVTCIGKINGGCRLKVL
DAGGRELELHSLGFDHFG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGAATTCGACTTCATCAAACGGTATTTGCAAACAGGTACGGATAA
GGATGTCGTATTGGGCATAGGCGACGATGCGGCGATTGTCCGCCCGCGCG
AAGGCTTCGATTTGTGTTTCAGTGCGGATATGCTTTTGAAGGACAGGCAT
TTTTTTGCAGATGTCAAACCTGAAGGCTTGGCTTGGAAGGTTTTGGCCGT
CAATATTTCAGATATGGCGGCGATGGGTGCGATACCGCGTTGGGTGCTGC
TGAGCGCGGCGTTGCCCGAATTGGATGAAGTATGGCTGGAACGGTTTTGC
GGCAGCTTTTTCGGTTTGGCAAAAAAGTTTGGCGTAACGTTAATCGGCGG
CGATACGACCAAGGGCGATATGGCGTTCAATGTAACCATTATCGGCGAAT
TGCCGAAGGGTAGGGCGTTGCGGCGTGATGCGGCGGTTGCGGGCGACGAT
ATTTGGGTGTCGGGGCGTGTCGGTATGGCGGCGGCGGCTTTGAACTGCCG
TCTGAAACGGTGTGTGTTGCCGGATGATGTGTTCGCCGAATGCGAACAAA
AGCTGCTCCGTCCCGAGCCAAGGGTTGGGCTGGGGCTTGCGCTGTTGCCG
TTTGCCCGGGCGGCACAGGATGTTTCAGACGGCCTTGCGCAAGATTTGGG
GCATATCCTGACCGCTTCCGGCGTGGGGGCGGAAATTTGGGCCGATTCGC
TGCCATCTTTATCTGTATTGAAAGATATTTTGCCCCGAGCGCAATGGCTG
TCTTATACTTTGGCGGGCGGCGACGATTACGAGCTGGTTTTTACCGCTCC
GGAAAGTTGCCGCAGCCGCGTGCTTGATGCGGCGGAACGGTGCGGCGTGC
CGGTAACGTGCATCGGCAAAATCAACGGAGGATGCCGTCTGAAGGTTTTA
GATGCCGGCGGCAGGGAATTGGAACTACATTCTTTAGGATTCGATCATTT
TGGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy