Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1284 IGR1285 IGR1283 IGR1287 IGR1288 IGR1282.5 IGR1284.1 IGR1286 IGR1282.4 IGR1282.3 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 NG1570 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 NG1570 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573 Type: tandem, Name:  - 73 NG1575.1 galM, - NG1571 omp3, - NG1577 NG1579 thiL, - NG1575 NG1572 NG1570 pgpA, - NG1574 pgpA, - NG1574 NG1576 cysB, - NG1578 hemN, - NG1580 yjjK, - NG1573
* Calculated from Protein Sequence

Gene ID: NG1574

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgpA  

Definition:
phosphatidylglycerophosphatase

Gene Start:
1549802

Gene Stop:
1549320

Gene Length:
483

Molecular Weight*:
17723

pI*:
5.70

Net Charge*:
-1.72

EC:
3.1.3.27  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism

Secondary Evidence:
Icho,T.
Membrane-bound phosphatases in Escherichia coli: sequence of the
pgpA gene
J. Bacteriol. 170 (11), 5110-5116 (1988)
Medline: 89033892

Comment:
This enzyme is one of the three phospholipid phosphatases.It specifically hydrolyzes phosphatidylglycerophosphate.

Oklahoma ID: NGO.1574c

Blast Summary:  PSI-Blast Search
Residues 1-161 in NG1574 have 96% similarity to residues 1-161 in AL162758, N. meningitidis Z2491 phosphatidylglycerophosphatase A.

Significant hits in gapped BLAST to phosphatidylglycerophosphatase A sequences, e.g.residues 12-155 in NG1574 have 46% similarity to residues 10-157 in AE004298, V. cholerae phosphatidylglycerophosphatase A.Residues 12-155 in NG1574 have 46% similarity to residues 17-159 in AE000148, E. coli K12 phosphatidylglycerophosphatase.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1267
COG name: Phosphatidylglycerophosphatase A
Functional Class:  I
The phylogenetic pattern of COG1267 is -mtk-q--eB-huj------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 15-155 are 45% similar to a (PROTEIN PHOSPHATIDYLGLYCEROPHOSPHATASE A) protein domain (PD016242) which is seen in PGPA_HAEIN.



Paralogs:  Local Blast Search


NG1574 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 15 to 160 (E-value = 5.3e-87) place NG1574 in the PgpA family which is described as Phosphatidylglycerophosphatase A (PF04608)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
102
cleavable N-terminal sequence  
1  
39
transmembrane  
47  
63
transmembrane  
86  
102
transmembrane  
145  
161

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LADFKPDFAWLLKRPLCFLAFGFGSGLVPFAPGTFGTLAALPLAFVLILL
GIDGLLLAFVCIVLFMWGIRICACAERETGVSDHGGIVWDEIVAMLFVLA
FVPFRWTWWLAAFVLFRLFDALKPPPVGWFDKNLHGGLGIMADDMAAAVM
TLIVLRIAMLF

Gene Nucleotide Sequence:  Sequence Viewer
TTGGCTGATTTTAAACCTGACTTTGCGTGGCTGTTGAAACGGCCGTTGTG
TTTTTTGGCTTTCGGTTTCGGCAGCGGGCTGGTTCCGTTTGCGCCGGGCA
CATTCGGCACTTTGGCGGCACTGCCTTTGGCGTTTGTGCTGATTTTGCTC
GGCATAGACGGGCTGCTGCTGGCTTTTGTGTGTATCGTGCTGTTTATGTG
GGGCATACGTATTTGTGCGTGTGCGGAACGTGAAACGGGTGTCAGCGACC
ACGGTGGGATTGTTTGGGACGAGATTGTCGCCATGCTGTTTGTGCTGGCG
TTTGTGCCGTTCAGGTGGACGTGGTGGCTGGCGGCATTTGTTCTGTTCCG
TCTGTTTGATGCGCTCAAACCGCCCCCCGTCGGTTGGTTTGACAAGAATC
TGCACGGCGGTTTGGGCATTATGGCGGACGATATGGCGGCTGCGGTGATG
ACCTTGATTGTCTTGAGGATTGCAATGCTGTTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy