Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1281 IGR1276 IGR1279 IGR1280 IGR1278 IGR1282 IGR1282.2 IGR1282.3 IGR1282.1 arsR, - NG1562 NG1568.1 NG1569 nadC, - NG1565 NG1566 NG1570 NG1563 NG1564 nadA, - NG1567 nadB, - NG1568 arsR, - NG1562 NG1568.1 NG1569 nadC, - NG1565 NG1566 NG1570 NG1563 NG1564 nadA, - NG1567 nadB, - NG1568 Type: tandem, Name:  - 72 Type: tandem, Name:  - 73 Type: inverse, Name:  - 162 Type: inverse, Name:  - 172 arsR, - NG1562 NG1568.1 NG1569 nadC, - NG1565 NG1566 NG1570 NG1564 nadA, - NG1567 nadB, - NG1568 NG1563
* Calculated from Protein Sequence

Gene ID: NG1568

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nadB  

Definition:
L-aspartate oxidase (NadB)

Gene Start:
1539530

Gene Stop:
1541035

Gene Length:
1506

Molecular Weight*:
54927

pI*:
6.90

Net Charge*:
-1.35

EC:
1.4.3.16  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  

Pathway: pathway table
Alanine and aspartate metabolism

Secondary Evidence:
Flachmann,R., Kunz,N., Seifert,J., Gutlich,M., Wientjes,F.J.,
Laufer,A. and Gassen,H.G.
Molecular biology of pyridine nucleotide biosynthesis in
Escherichia coli. Cloning and characterization of quinolinate
synthesis genes nadA and nadB
Eur. J. Biochem. 175 (2), 221-228 (1988)
Medline: 88296484

Seifert,J., Kunz,N., Flachmann,R., Laufer,A., Jany,K.D. and
Gassen,H.G.
Expression of the E. coli nadB gene and characterization of the
gene product L-aspartate oxidase
Biol. Chem. Hoppe-Seyler 371 (3), 239-248 (1990)
Medline: 90253646

Mattevi,A., Tedeschi,G., Bacchella,L., Coda,A., Negri,A. and
Ronchi,S.
Structure of L-aspartate oxidase: implications for the succinate
dehydrogenase/fumarate reductase oxidoreductase family
Structure 7, 745-756 (1999)



Comment:
Oklahoma ID: NGO.1568

For other 'nad' genes, see NG1565 (nadC), NG1567 (nadA), NG0654 (nadE).

Blast Summary:  PSI-Blast Search
Residues 1-502 in NG1568 have 95% similarity to residues 1-502 in AE002395, N. meningitidis MC58 l-aspartate oxidase.

Numerous hits in gapped BLAST to L-aspartate oxidase sequences, e.g. residues 6-501 in NG1568 have 45% similarity to residues 8-518 in AE004511, P. aeruginosa L-aspartate oxidase.
Residues 5-501 in NG1568 have 43% similarity to residues 24-533 in AE004316, V. cholerae l-aspartate oxidase.

COGS Summary:  COGS Search
BeTs to 5 clades of COG0029
COG name: Aspartate oxidase
Functional Class:  H
The phylogenetic pattern of COG0029 is ---k-q-cebr----------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003952 (Fumarate reductase / succinate dehydrogenase FAD-binding site) with a combined E-value of 4.5e-42.
    IPB003952A    6-20
    IPB003952B    26-55
    IPB003952E    119-136
    IPB003952F    205-255
    IPB003952G    296-347
    IPB003952H    356-387
    IPB003952I    411-463
    IPB003952J    467-502


ProDom Summary:  Protein Domain Search
Residues 114-390 are 53% similar to a (FLAVOPROTEIN SUBUNIT OXIDOREDUCTASE FAD DEHYDROGENASE) protein domain (PD001219) which is seen in NADB_PSEAE.

Residues 29-100 are 43% similar to a (FLAVOPROTEIN SUBUNIT OXIDOREDUCTASE DEHYDROGENASE) protein domain (PD149640) which is seen in NADB_ECOLI.



Paralogs:  Local Blast Search


NG1568 is paralogously related to NG0921 (succinate dehydrogenase flavoprotein subunit) (4e-59).


Pfam Summary:  Pfam Search
Residues 102 to 410 (E-value = 6.1e-122) place NG1568 in the FAD_binding_2 family which is described as FAD binding domain (PF00890)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
54
transmembrane  
7  
23

PDB Hit:
pdb|1CHU|1CHU-A STRUCTURE OF L-ASPARTATE OXIDASE: IMPLICATIONS 351.0 2e-97
pdb|1KNP|1KNP-A E. COLI L-ASPARTATE OXIDASE: MUTANT R386L IN 348.0 1e-96
pdb|1KF6|1KF6-A E. COLI QUINOL-FUMARATE REDUCTASE WITH BOUND 196.0 6e-51
pdb|1E7P|1E7P-G QUIN

Gene Protein Sequence:
MQTDCDVLIAGNGLAALTLALSLPESFRIVILCKNRLDDTASRHAQGGIA
AAWSGEDDIGKHVADTLEAGAGLCDEAAVRTILSQGKPAIEWLLAQGVAF
DRNHNDLHLTREGGHTCRRIAHVADYTGEAVMQSLIIQIRRRPNIRVYER
QMALDVQTESGAACGLTVLDCRTQETYRIRARHTVLAGGGLGQIYAATTT
PPECTGDAIAMAIRAGCAIENLEFIQFHPTGLARPSENGRTFLISEAVRG
EGGILTNQSGERFMPHYDRRAELAPRDIVARAIAAETAKQTQDFVSLDIS
RQPAAFVRRHFPSIHRHCLSQCGLDITRQAIPVRPVQHYTCGGIQTDPSG
RTSLPQLYALGETACTGLHGANRLASNSLLECVVTARLAAQGIADGQAFQ
IEPFQRPSESPSAETDIFSNDLQNTFSRPVLQTFNQRHLGILRNDTDLHR
AIDQLRLWKQNQAEPHTASEYENRNLLECSLAVAQAAYRRRQNIGAHFNS
DC

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAACCGATTGCGACGTATTGATTGCCGGAAACGGGCTGGCGGCACT
GACGCTCGCCCTGTCGCTGCCTGAATCGTTCCGCATCGTCATTTTGTGCA
AAAACCGGCTGGACGACACCGCCAGCCGTCATGCGCAAGGCGGGATTGCG
GCGGCGTGGTCGGGAGAGGACGACATCGGAAAACACGTCGCCGATACTTT
GGAAGCGGGCGCAGGTTTGTGCGACGAAGCCGCCGTCCGCACCATCCTGT
CGCAGGGCAAACCGGCAATCGAATGGCTGCTGGCGCAGGGCGTGGCGTTC
GACCGGAATCATAACGACCTGCACCTGACGCGCGAAGGCGGGCATACCTG
CCGCCGAATCGCCCACGTCGCCGACTACACGGGCGAAGCCGTCATGCAGA
GCCTGATTATCCAAATACGCCGCCGACCGAACATCCGCGTTTACGAGCGG
CAGATGGCGTTGGACGTTCAAACCGAATCAGGCGCAGCGTGCGGACTGAC
CGTCCTCGACTGCCGAACGCAAGAAACCTACCGCATCCGTGCCCGCCATA
CCGTACTCGCAGGCGGCGGCCTCGGGCAAATTTACGCCGCCACCACCACG
CCGCCCGAATGCACGGGCGACGCCATCGCCATGGCGATACGCGCGGGTTG
CGCAATCGAAAACCTCGAATTTATCCAATTCCACCCCACAGGCTTGGCAA
GGCCGTCTGAAAACGGCCGCACCTTCCTGATTTCCGAAGCCGTGCGCGGC
GAAGGCGGCATCCTGACCAATCAATCGGGCGAACGGTTTATGCCGCATTA
CGACCGCCGCGCCGAACTCGCGCCGCGCGACATCGTTGCCCGCGCCATCG
CCGCCGAAACCGCCAAACAAACGCAAGACTTCGTCTCGCTCGACATCAGC
CGCCAACCCGCAGCGTTCGTCCGTCGGCATTTCCCGTCCATCCATCGGCA
CTGCCTGTCCCAATGCGGCTTGGACATCACGCGCCAAGCCATCCCCGTCC
GCCCCGTGCAACACTACACCTGCGGCGGCATCCAAACCGACCCCAGCGGC
AGAACCTCCCTGCCGCAGCTCTACGCCTTAGGCGAAACCGCCTGTACCGG
ACTGCACGGAGCCAACCGCCTCGCCAGCAACTCCCTGCTCGAATGCGTCG
TTACCGCCAGGCTTGCCGCCCAAGGCATCGCGGACGGACAAGCGTTCCAA
ATCGAACCATTCCAAAGGCCGTCTGAAAGCCCCTCCGCCGAAACAGACAT
CTTTTCAAACGACCTCCAAAACACATTCAGCCGCCCTGTCCTGCAAACGT
TCAACCAACGCCATCTCGGCATCCTCCGCAACGATACCGACCTGCACCGC
GCCATCGACCAACTGCGGCTTTGGAAGCAAAACCAAGCCGAACCGCACAC
CGCGTCCGAATACGAAAACCGCAACCTACTCGAATGCAGCCTCGCCGTCG
CCCAAGCCGCATACAGGCGGAGACAGAACATCGGTGCGCATTTTAATAGT
GATTGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy