Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1274 IGR1281 IGR1276 IGR1275 IGR1279 IGR1273 IGR1280 IGR1278 IGR1282 IGR1282.2 IGR1282.1 arsR, - NG1562 NG1568.1 xthA, - NG1561 NG1569 nadC, - NG1565 NG1566 NG1570 NG1560 NG1563 NG1564 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 arsR, - NG1562 NG1568.1 xthA, - NG1561 NG1569 nadC, - NG1565 NG1566 NG1570 NG1560 NG1563 NG1564 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 Type: inverse, Name:  - 162 Type: inverse, Name:  - 172 arsR, - NG1562 NG1568.1 xthA, - NG1561 NG1569 nadC, - NG1565 NG1566 NG1570 NG1564 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 NG1560 NG1563
* Calculated from Protein Sequence

Gene ID: NG1567

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nadA  

Definition:
quinolinate synthetase (NadA)

Gene Start:
1538333

Gene Stop:
1539475

Gene Length:
1143

Molecular Weight*:
41255

pI*:
6.00

Net Charge*:
-6.04

EC:
1.4.3.-  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  

Pathway: pathway table
Arginine and proline metabolism

Secondary Evidence:
Flachmann,R., Kunz,N., Seifert,J., Gutlich,M., Wientjes,F.J.,
Laufer,A. and Gassen,H.G.
Molecular biology of pyridine nucleotide biosynthesis in
Escherichia coli. Cloning and characterization of quinolinate
synthesis genes nadA and nadB
Eur. J. Biochem. 175 (2), 221-228 (1988)
M:88296484


Comment:
Oklahoma ID: NGO.1567

For other 'nad' genes, see NG1565 (nadC), NG0654 (nadE), NG1568 (nadB).

Blast Summary:  PSI-Blast Search
Residues 12-381 in NG1567 have 96% similarity to residues 1-370 in AE002395, N. meningitidis MC58 quinolinate synthetase A.
Residues 56-370 in NG1567 have 64% similarity to residues 30-346 in AP002553, E. coli O157:H7 quinolinate synthetase A protein.
Residues 63-365 in NG1567 have 68% similarity to residues 38-340 AE004533, P. aeruginosa quinolinate synthetase A.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0379
COG name: Quinolinate synthase
Functional Class:  H
The phylogenetic pattern of COG0379 is -mtk-qvcebr-uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003473 (Quinolinate synthetase A protein) with a combined E-value of 4.1e-104.
    IPB003473A    59-84
    IPB003473B    153-193
    IPB003473C    199-216
    IPB003473D    222-250
    IPB003473E    251-302
    IPB003473B    240-280


ProDom Summary:  Protein Domain Search
Residues 57-366 are 65% similar to a (QUINOLINATE SYNTHETASE A PYRIDINE) protein domain (PD005431) which is seen in NADA_ECOLI.



Paralogs:  Local Blast Search


NG1567 is paralogously related to NG1914 (6-phosphogluconate dehydrogenase, decarboxylating (Gnd)) (9e-04).


Pfam Summary:  Pfam Search
Residues 55 to 365 (E-value = 1.3e-150) place NG1567 in the NadA family which is described as Quinolinate synthetase A protein (PF02445)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPSENQLQGNIMQTAARRSFDYDMPLIQTPTSACQIRQAWAKVADTPDHE
TAGRLKDEIKVLLKRKNAVLVAHYYVDPLIQDLALETGGCVGDSLEMARF
GAEHEAGTLVVAGVRFMGESAKILCPEKTVLMPDLEAECSLDLGCPEEAF
SAFCDQHPDRTVAVYANTSAAVKARADWVVTSSVALEIVSYLKSRGEKLI
WGPDRHLGDYIRRETGADMLLWQGSCIVHNEFKGQELAALKAEHPDAVVL
VHPESPQSVIELGDVVGSTSKLLKAAVSRPEKKFIVATDLGILHEMQKQA
PDKEFIAAPTAGNGGSCKSCAFCPWMAMNSLGGIKHALTGGRNEILLDRK
LGEAAKLPLQRMLDFAAGLKRGDVFNGMGPA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAAACCAGCTACAAGGAAACATCATGCAAACCGCCGCCCG
CCGCTCGTTCGATTACGATATGCCCCTCATCCAAACGCCGACTTCCGCCT
GCCAAATCCGTCAGGCGTGGGCGAAGGTTGCCGACACGCCCGACCACGAG
ACGGCAGGTCGTCTGAAAGACGAAATCAAGGTCTTGCTGAAGCGGAAAAA
CGCGGTCTTGGTGGCGCATTATTACGTCGATCCGCTGATTCAGGATTTGG
CTTTGGAGACGGGCGGATGCGTGGGCGATTCGCTGGAAATGGCGCGCTTC
GGCGCGGAACACGAAGCCGGTACGCTGGTGGTGGCGGGCGTGCGTTTCAT
GGGCGAGAGCGCGAAAATCCTCTGCCCTGAAAAAACGGTGCTGATGCCTG
ATTTGGAAGCGGAATGTTCTTTGGATTTGGGTTGTCCCGAAGAAGCGTTT
TCAGCGTTTTGCGACCAACACCCCGACCGCACGGTGGCGGTGTACGCCAA
TACTTCCGCAGCCGTGAAAGCGCGTGCCGACTGGGTGGTAACGTCTTCGG
TGGCGTTGGAAATCGTGTCGTATCTGAAATCGCGCGGCGAGAAACTGATT
TGGGGACCCGACCGCCACCTCGGCGACTACATCCGCCGCGAAACGGGCGC
GGATATGCTGTTGTGGCAGGGTTCGTGCATCGTCCATAACGAATTCAAAG
GGCAGGAACTGGCGGCGTTGAAGGCAGAGCATCCCGATGCTGTGGTGCTG
GTTCATCCCGAATCGCCGCAAAGCGTCATCGAACTGGGCGACGTGGTCGG
CTCGACCAGCAAACTACTCAAAGCCGCCGTATCGCGCCCTGAAAAAAAAT
TCATCGTGGCAACCGATTTGGGCATCCTGCACGAAATGCAAAAGCAGGCG
CCCGACAAAGAATTTATCGCCGCGCCGACGGCGGGCAACGGCGGAAGCTG
TAAAAGCTGCGCGTTCTGCCCGTGGATGGCGATGAATTCGCTGGGCGGCA
TCAAACACGCCCTGACAGGCGGACGCAACGAAATCCTGTTGGACAGAAAG
CTGGGCGAAGCCGCCAAACTGCCTTTGCAGCGTATGCTCGACTTCGCGGC
AGGACTCAAACGCGGGGATGTGTTCAACGGCATGGGGCCCGCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy