Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1270 IGR1274 IGR1281 IGR1276 IGR1275 IGR1279 IGR1273 IGR1272 IGR1271 IGR1280 IGR1278 IGR1282 IGR1269.1 NG1558 arsR, - NG1562 NG1556 NG1568.1 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 NG1558 arsR, - NG1562 NG1556 NG1568.1 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 Type: direct, Name:  - 129 Type: inverse, Name:  - 157 Type: inverse, Name:  - 162 Type: inverse, Name:  - 172 NG1558 arsR, - NG1562 NG1556 NG1568.1 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 NG1563
* Calculated from Protein Sequence

Gene ID: NG1565

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nadC  

Definition:
nicotinate-nucleotide pyrophosphorylase (NadC)

Gene Start:
1537150

Gene Stop:
1536272

Gene Length:
879

Molecular Weight*:
31177

pI*:
5.30

Net Charge*:
-7.59

EC:
2.4.2.19  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pyridine nucleotides  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Hughes,K.T., Dessen,A., Gray,J.P. and Grubmeyer,C.
The Salmonella typhimurium nadC gene: sequence determination by use of Mud-P22 and purification of quinolinate
phosphoribosyltransferase
J. Bacteriol. 175 (2), 479-486 (1993)
M:93123167


Comment:
Oklahoma ID: NGO.1565c

For other 'nad' genes, see NG0654 (nadE), NG1567 (nadA), NG1568 (nadB).

Blast Summary:  PSI-Blast Search
Residues 1-293 in NG1565 have 96% similarity to residues 1-293 in AL162758, N. meningitidis Z2491 nicotinate-nucleotide pyrophosphorylase.
Residues 7-291 in NG1565 have 50% similarity to residues 3-281 in AE004012, X. fastidiosa nicotinate-mononucleotide pyrophosphorylase.
Residues 7-293 in NG1565 have 51% similarity to residues 4-284 in AF311738, M. loti NadC.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0157
COG name: Nicotinate-nucleotide pyrophosphorylase
Functional Class:  H
The phylogenetic pattern of COG0157 is amtkyqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002638 (Quinolinate phosphoribosyl transferase) with a combined E-value of 1e-25.
    IPB002638    141-177


ProDom Summary:  Protein Domain Search
Residues 27-290 are 45% similar to a (TRANSFERASE NICOTINATE-NUCLEOTIDE) protein domain (PD003988) which is seen in NADC_RHORU.



Paralogs:  Local Blast Search


NG1565 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 28 to 117 (E-value = 1.5e-27) place NG1565 in the QRPTase_N family which is described as Quinolinate phosphoribosyl transferase, N-terminal domain (PF02749)
Residues 119 to 290 (E-value = 9.8e-69) place NG1565 in the QRPTase_C family which is described as Quinolinate phosphoribosyl transferase, C-terminal domain (PF01729)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
54  
150

PDB Hit:
pdb|1QPN|1QPN-A QUINOLINATE PHOSPHORIBOSYL TRANSFERASE FROM 182.0 9e-47
pdb|1QAP|1QAP-A QUINOLINIC ACID PHOSPHORIBOSYLTRANSFERASE WITH 166.0 5e-42
pdb|1QPN|1QPN-A QUINOLINATE PHOSPHORIBOSYL TRANSFERASE FROM 358.0 0e+00

Gene Protein Sequence:
MPSENPLFALPDTLLRPMVEQALSEDLGRRGDITSAAVIAPDKTAKLFLV
SREDGVIAGMDLARLAFQTMDPCVRFQAEIQDGQAVRAGQTLAAVEGNAR
ALLAAERTALNYLTHLSGIATATARAVAEVAEYGTDIVCSRKTIPLLRVL
QKYAVRAGGGANHRMGLDDAVLIKDNHLAYCGSIAQAVRQAKQAVGPLTC
VEIEVDTLAQLDEAIAAGAERILLDNMDDETLKEAANRCHTQTAHPHTVY
CEASGGIGFDRLKRVAQTGVDGIALGYLTHSSRSLDIGLDFVA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGTCTGAAAACCCCCTCTTTGCCCTGCCCGACACCTTGTTGCGCCC
CATGGTGGAACAAGCCTTGAGCGAAGACTTGGGCAGGCGCGGCGACATTA
CGTCCGCCGCCGTCATCGCGCCCGACAAAACCGCCAAACTTTTCCTCGTC
AGCCGCGAAGACGGTGTTATCGCCGGTATGGACTTGGCGCGCCTCGCCTT
TCAGACGATGGATCCGTGCGTCCGCTTCCAAGCCGAAATCCAAGACGGGC
AAGCCGTCCGCGCAGGTCAGACACTGGCTGCCGTCGAAGGCAACGCCCGC
GCGCTGCTCGCCGCCGAACGCACCGCGCTCAACTACCTCACGCACTTGAG
CGGCATCGCCACCGCCACCGCTCGTGCCGTTGCCGAGGTCGCCGAATACG
GTACAGACATCGTGTGCAGCCGCAAAACCATCCCCCTGCTGCGCGTCCTG
CAAAAATACGCCGTCAGGGCGGGCGGCGGCGCGAACCACCGCATGGGTTT
GGACGACGCCGTGCTCATCAAAGACAACCACCTCGCCTATTGCGGCAGCA
TCGCCCAAGCCGTTCGGCAGGCAAAACAGGCGGTCGGACCGTTGACCTGC
GTGGAAATCGAAGTGGACACGTTGGCACAACTGGACGAAGCCATCGCAGC
GGGCGCGGAACGGATTTTGCTGGACAACATGGACGACGAAACCCTGAAAG
AAGCGGCAAACCGCTGCCACACACAAACCGCCCACCCACACACCGTCTAT
TGCGAAGCATCGGGCGGCATCGGCTTCGACCGCCTGAAGCGCGTGGCGCA
AACCGGCGTGGACGGCATCGCCCTCGGCTATCTGACCCACAGCAGCCGAT
CGTTGGACATAGGTTTGGATTTCGTGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy