Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1270 IGR1274 IGR1281 IGR1276 IGR1275 IGR1279 IGR1273 IGR1272 IGR1271 IGR1280 IGR1278 IGR1269.1 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 Type: direct, Name:  - 129 Type: inverse, Name:  - 157 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 NG1563
* Calculated from Protein Sequence

Gene ID: NG1562

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
arsR  

Definition:
ArsR-family transcriptional regulator

Gene Start:
1535534

Gene Stop:
1535256

Gene Length:
279

Molecular Weight*:
10560

pI*:
10.20

Net Charge*:
3.90

EC:
 

Functional Class:
Regulatory functions  

Pathway: pathway table

Comment:
For other 'ars' genes see NG1924 (arsC).

Oklahoma ID: NGO.1562c

Blast Summary:  PSI-Blast Search
Residues 1-93 in NG1562 have 89% similarity to residues 1-93 in AE002395, N. meningitidis MC58 transcriptional regulator, ArsR family.

Significant hits in gapped BLAST to transcription regulator sequences , e.g. residues 9-87 in NG1562 have 30% similarity to residues 24-102 in AE004394, V. cholerae transcriptional regulator, ArsR family.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0640
COG name: Predicted transcriptional regulators
Functional Class:  K
The phylogenetic pattern of COG0640 is AMTK-qVCEBR----------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001845 (Bacterial regulatory proteins, ArsR family) with a combined E-value of 1.5e-15.
    IPB001845A    10-25
    IPB001845B    28-72


ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1562 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 10 to 87 (E-value = 1.7e-13) place NG1562 in the HTH_5 family which is described as Bacterial regulatory protein, arsR family (PF01022)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
14

PDB Hit:
pdb|1SMT|1SMT-A SMTB REPRESSOR FROM SYNECHOCOCCUS PCC7942 122.0 1e-29

Gene Protein Sequence:
MNTIPLHTILKLMAHPERMAILIQLLDSERNIVELAKSLSLTATAVSCHL
NRLRAGGLVDFTRYHRIIEYRLVSEDAATILRTIRDLENKRAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACACAATACCGCTCCACACCATACTCAAACTTATGGCGCATCCCGA
ACGTATGGCGATACTGATCCAACTGTTGGACAGCGAACGCAATATCGTCG
AACTGGCAAAATCCTTATCCCTGACGGCCACCGCGGTTTCCTGTCATTTG
AACCGCCTGAGGGCGGGCGGTCTGGTGGACTTTACGCGTTACCACCGCAT
TATCGAATACCGCCTGGTTTCCGAAGACGCGGCAACGATTCTGCGGACAA
TCCGCGATTTGGAAAACAAACGCGCGGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy