Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1277 IGR1270 IGR1274 IGR1281 IGR1276 IGR1275 IGR1279 IGR1273 IGR1272 IGR1271 IGR1280 IGR1278 IGR1269.1 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1563 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 Type: direct, Name:  - 129 Type: inverse, Name:  - 157 NG1558 arsR, - NG1562 NG1556 xthA, - NG1561 nadC, - NG1565 NG1566 NG1560 NG1564 NG1557 ompA,yiaD, - NG1559 nadA, - NG1567 nadB, - NG1568 putA, - NG1554 NG1563
* Calculated from Protein Sequence

Gene ID: NG1561

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
xthA  

Definition:
exodeoxyribonuclease III

Gene Start:
1535193

Gene Stop:
1534426

Gene Length:
768

Molecular Weight*:
29168

pI*:
5.70

Net Charge*:
-5.50

EC:
3.1.11.2  

Functional Class:
Replication; Degradation of DNA  

Pathway: pathway table

Secondary Evidence:
Shida,T., Noda,M. and Sekiguchi,J.
Cleavage of single- and double-stranded DNAs containing an abasic
residue by Escherichia coli exonuclease III (AP endonuclease VI)
Nucleic Acids Res. 24 (22), 4572-4576 (1996)
Medline: 97105903

Mol,C.D., Kuo,C.F., Thayer,M.M., Cunningham,R.P. and Tainer,J.A.
Structure and function of the multifunctional DNA-repair enzyme
exonuclease III
Nature 374 (6520), 381-386 (1995)
Medline: 95191690


Comment:
Oklahoma ID: NGO.1561c

Blast Summary:  PSI-Blast Search
Residues 1-255 in NG1561 have 93% similarity to residues 1-255 in AL162758, N. meningitidis Z2491 exodeoxyribonuclease III.


Numerous hits in gapped BLAST to exodeoxyribonuclease III sequences,e.g residues 1-256 in NG1561 have 49% similarity to residues 3-258 in AE004013, X. fastidiosa exodeoxyribonuclease III.Residues 1-256 in NG1561 have 41% similarity to residues 2-257 in AE001064, A. fulgidus exodeoxyribonuclease III (xthA).


COGS Summary:  COGS Search
BeTs to 11 clades of COG0708
COG name: Exonuclease III
Functional Class:  L
The phylogenetic pattern of COG0708 is a-t-y--cebrhuj--ol--X
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000097 (AP endonucleases family 1) with a combined E-value of 5.9e-60.
    IPB000097A    1-13
    IPB000097B    27-36
    IPB000097C    59-96
    IPB000097D    139-173
    IPB000097E    198-245


ProDom Summary:  Protein Domain Search
Residues 1-250 are 41% similar to a (PROTEIN ENDONUCLEASE EXODEOXYRIBONUCLEASE) protein domain (PD002469) which is seen in O29675_ARCFU.



Paralogs:  Local Blast Search


NG1561 is paralogously related to NG1994 (exodeoxyribonuclease III) (6e-23).


Pfam Summary:  Pfam Search
Residues 1 to 254 (E-value = 8.6e-45) place NG1561 in the Exo_endo_phos family which is described as Endonuclease/Exonuclease/phosphatase family (PF03372)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
91  
107

PDB Hit:
pdb|1AKO|1AKO EXONUCLEASE III FROM ESCHERICHIA COLI 176.0 5e-45
pdb|1DEW|1DEW-A CRYSTAL STRUCTURE OF HUMAN APE1 BOUND TO ABASIC 108.0 9e-25
pdb|1DE8|1DE8-B HUMAN APURINIC/APYRIMIDINIC ENDONUCLEASE-1 108.0 9e-25
pdb|1BIX|1BIX THE C

Gene Protein Sequence:
MKITTWNVNSLNVRLPQVQNLLVDNPPDILVLQELKLDQDKFPAAALQMM
GWHCVWSGQKTYNGVAIVSRSVPQDVHFGLPSLPDDPQRRVIAATVGGVR
VINVYCVNGEALDSPKFKYKEQWFAALTEFVRDEMSRHGKLVLLGDFNIA
PADADCYDPEKWYEKIHCSSVERQWFQNLLDLGLTDSLRQVHPEGAFYTW
FDYRGAMFQRKLGLRIDHILVTSEMAAVLKDVRIDLETRALERPSDHAPV
AAEFDL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCACCACTTGGAACGTCAATTCGCTCAATGTGCGGCTGCCGCA
GGTGCAAAACCTGCTTGTCGACAATCCGCCCGATATTTTGGTTTTGCAGG
AACTCAAACTCGATCAGGACAAATTTCCGGCCGCCGCCTTGCAGATGATG
GGCTGGCACTGTGTTTGGAGCGGGCAGAAAACCTACAACGGCGTGGCAAT
CGTCAGCCGCAGCGTGCCGCAGGACGTGCATTTCGGTTTGCCTTCCCTGC
CGGATGACCCGCAACGCCGCGTGATTGCGGCGACCGTCGGCGGCGTGCGC
GTCATCAATGTCTATTGCGTCAACGGCGAAGCCCTCGACAGCCCCAAATT
CAAATATAAGGAACAATGGTTTGCCGCACTGACGGAGTTTGTCCGCGATG
AAATGTCCCGCCACGGCAAACTGGTGCTGCTGGGCGATTTCAATATCGCG
CCTGCCGATGCGGACTGTTACGACCCTGAAAAATGGTATGAAAAAATCCA
CTGTTCGTCCGTCGAACGGCAGTGGTTTCAAAACCTGCTGGATTTGGGAT
TGACCGACAGCCTGCGCCAAGTCCATCCCGAAGGCGCGTTCTATACCTGG
TTCGACTATCGCGGCGCGATGTTCCAACGCAAACTGGGCCTGCGTATCGA
CCATATATTGGTTACATCCGAAATGGCGGCCGTTTTGAAGGATGTCCGCA
TCGATTTGGAGACGCGCGCGCTGGAGCGTCCGAGCGACCACGCGCCCGTG
GCGGCAGAATTTGATTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy