Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-3 tRNA-Met-2 IGR1264 IGR1266 IGR1260 IGR1263 IGR1259 IGR1265 IGR1267 IGR1261 IGR1262 ftsL, - NG1543 NG1545 dsbA, - NG1548 NG1551 bacA, - NG1547 NG1549 NG1544 comM, - NG1550 pbp2,penA, - NG1542 NG1546 putP, - NG1552 ftsL, - NG1543 NG1545 dsbA, - NG1548 NG1551 bacA, - NG1547 NG1549 NG1544 comM, - NG1550 pbp2,penA, - NG1542 NG1546 putP, - NG1552 NG1545 dsbA, - NG1548 NG1551 bacA, - NG1547 NG1549 NG1544 comM, - NG1550 pbp2,penA, - NG1542 ftsL, - NG1543 NG1546 putP, - NG1552
* Calculated from Protein Sequence

Gene ID: NG1548

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dsbA  

Definition:
thiol-disulfide isomerase (DsbA)

Gene Start:
1522392

Gene Stop:
1521751

Gene Length:
642

Molecular Weight*:
23988

pI*:
10.20

Net Charge*:
10.35

EC:
5.3.4.1  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Hayashi,S., Abe,M., Kimoto,M., Furukawa,S. and Nakazawa,T. The dsbA-dsbB disulfide bond formation system of Burkholderia cepacia is involved in the production of protease and alkaline phosphatase, motility, metal resistance, and multi-drug resistance. Microbiol. Immunol. 44 (1): 41-50 (2000) [Medline: 20174740].

Comment:
Oklahoma ID: NGO.1548c

From GenBANK (gi:11132451): DsbA is involved in disulfide-bond formation. It acts by transferring its disulfide bond to other proteins. It is involved in the production of protease and alkaline phosphatase, motility, metal resistance, and multi-drug resistance. This periplasmic protein belongs to the thioredoxin family, DsbA subfamily.

See also: DsbA, NG1717; DsbB, NG1292; DsbC, NG1438; and DsbD, NG0978.

Blast Summary:  PSI-Blast Search
Residues 1-214 in NG1548 have 95% similarity to residues 1-214 in AE002396, N. meningitidis MC58 thiol:disulfide interchange protein DsbA.
Residues 15-190 have 33% similarity to residues 18-190 in AF116282, P. aeruginosa thiol:disulfide interchange protein DsbA precursor.


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB001853 (DSBA oxidoreductase) with a combined E-value of 1.4e-15.
    IPB001853A    19-31
    IPB001853B    45-59
    IPB001853D    141-179


ProDom Summary:  Protein Domain Search
Residues 23-190 are 32% similar to a (REDOX-ACTIVE CENTER PROTEIN PRECURSOR) protein domain (PD004627) which is seen in DSBA_PSEAE.



Paralogs:  Local Blast Search


NG1548 is paralogously related to NG1717 (thiol:disulfide interchange protein (DsbA)) (5e-54).


Pfam Summary:  Pfam Search
Residues 44 to 199 (E-value = 7.8e-06) place NG1548 in the DSBA family which is described as DSBA-like thioredoxin domain (PF01323)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
21
cleavable N-terminal sequence  
1  
21

PDB Hit:
pdb|1BED|1BED STRUCTURE OF DISULFIDE OXIDOREDUCTASE 57.8 2e-09
pdb|1A23|1A23 SOLUTION NMR STRUCTURE OF REDUCED DSBA FROM 56.6 4e-09
pdb|1FVJ|1FVJ-A THE 2.06 ANGSTROM STRUCTURE OF THE H32Y MUTANT 54.3 2e-08
pdb|1BQ7|1BQ7-A DSBA

Gene Protein Sequence:
MKFKHLLPLLLSAVLSAQAYALTEGEDYLVLDKPIPQEQPGKIEVLEFFG
YFCVHCHHFDPLLLKLGKALPSDTYLRTEHVVWRPEMLGLARMAAAVKLS
GLKYQANSAVFKAVYEQKIRLENRAVAGKWALSQKGFDGKKLMRAYDSPE
AAAVALKMQKLTEQYGIDSTPTVIVGGKYRVIFNNGFDGGVHTIKELVAK
VREERKRQTPAVQK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGTTTAAACATCTGTTGCCGCTGCTGCTGTCGGCAGTGTTGTCCGC
GCAGGCATATGCCCTGACGGAAGGGGAAGACTATCTTGTGTTGGATAAAC
CCATTCCTCAAGAACAGCCGGGAAAAATTGAGGTTTTGGAATTTTTCGGC
TATTTTTGCGTACATTGCCATCATTTCGATCCTTTGTTATTGAAACTGGG
CAAGGCATTGCCGTCTGATACTTATCTGCGGACGGAGCACGTGGTCTGGC
GGCCTGAAATGCTCGGTCTGGCAAGAATGGCTGCTGCGGTCAAGCTGTCG
GGTTTGAAATATCAGGCAAACTCTGCTGTGTTTAAAGCAGTTTACGAACA
AAAAATCCGTTTGGAAAACAGGGCTGTTGCCGGGAAATGGGCTTTATCTC
AAAAAGGTTTTGACGGCAAAAAACTGATGCGCGCCTATGATTCCCCCGAA
GCTGCCGCCGTCGCATTAAAAATGCAGAAACTGACGGAACAATACGGTAT
TGACAGCACGCCGACCGTTATTGTCGGCGGAAAATACCGCGTTATCTTCA
ATAATGGCTTTGATGGCGGCGTTCATACGATTAAAGAATTGGTTGCCAAA
GTCAGGGAAGAACGCAAGCGTCAGACCCCTGCTGTACAGAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy