Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1257 IGR1258 IGR1260 IGR1259 IGR1256 IGR1255 IGR1261 NG1538 ftsL, - NG1543 NG1545 NG1544 mraY, - NG1537 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1546 NG1538 ftsL, - NG1543 NG1545 NG1544 mraY, - NG1537 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1546 NG1538 ftsL, - NG1543 NG1545 NG1544 mraY, - NG1537 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1546
* Calculated from Protein Sequence

Gene ID: NG1541

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murE  

Definition:
UDP-N-acetylmuramyl-tripeptide synthetase (MurE)

Gene Start:
1515395

Gene Stop:
1513920

Gene Length:
1476

Molecular Weight*:
52999

pI*:
6.60

Net Charge*:
-3.37

EC:
6.3.2.13  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Lysine biosynthesis
Peptideglycan biosynthesis

Secondary Evidence:
Michaud,C., Parquet,C., Flouret,B., Blanot,D. and van Heijenoort,J.
Revised interpretation of the sequence containing the murE gene
encoding the UDP-N-acetylmuramyl-tripeptide synthetase of
Escherichia coli
Biochem. J. 269 (1), 277-278 (1990)
Medline: 90328986

Michaud,C., Mengin-Lecreulx,D., van Heijenoort,J. and Blanot,D.
Over-production, purification and properties of the
uridine-diphosphate-N-acetylmuramoyl-L-alanyl-D-glutamate:
meso-2,6-diaminopimelate ligase from Escherichia coli
Eur. J. Biochem. 194 (3), 853-861 (1990)
Medline: 91099368


Comment:
Oklahoma ID: NGO.1541c

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG1533 (murG), NG1535 (murD), NG1539 (murF), NG0394 (murB), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-492 in NG1541 have 96% similarity to residues 1-492 in AE002397, N. meningitidis MC58 UDP-N-acetylmuramoylalanyl- D-glutamate--2, 6-diaminopimelate ligase.
Residues 24-488 in NG1541 have 49% similarity to residues 19-479 in AE004856, P. aeruginosa UDP-N-acetylmuramoylalanyl- D-glutamate-2, 6-diaminopimelate ligase.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0769
COG name: UDP-N-acetylmuramyl tripeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0769 is --T--qvCebRhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 384-488 are 49% similar to a (LIGASE SYNTHETASE) protein domain (PD039268) which is seen in O67631_AQUAE.

Residues 80-244 are 49% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001083) which is seen in MURE_HAEIN.

Residues 85-227 are 34% similar to a (UDP-N-ACETYLMURAMOYLALANYL-D-GLUTAMATE--2,) protein domain (PD212530) which is seen in MURE_TREPA.

Residues 320-383 are 53% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001216) which is seen in MURE_ECOLI.



Paralogs:  Local Blast Search


NG1541 is paralogously related to NG1535 (UDP-N-acetylmuramoylalanine--D-glutamate ligase (MurD)) (3e-10), NG1539 (UDP-MurNAc-pentapeptide synthetase (MurF)) (1e-05) and NG0815 (UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase) (3e-04).


Pfam Summary:  Pfam Search
Residues 35 to 327 (E-value = 7.7e-48) place NG1541 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 336 to 426 (E-value = 1e-27) place NG1541 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
399  
461

PDB Hit:
pdb|1E8C|1E8C-A STRUCTURE OF MURE THE UDP-N-ACETYLMURAMYL 351.0 1e-97
pdb|1GG4|1GG4-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 60.9 5e-10
pdb|1E8C|1E8C-A STRUCTURE OF MURE THE UDP-N-ACETYLMURAMYL 606.0 0e+00
pdb|1GG4|1GG4-A CRYS

Gene Protein Sequence:
MFSKLSPLAETGIPTLSCANAAGRLLHSDSRQIKQGDIFVACPGEYADGR
SYIPAAVANGAAFVFWDDDGRFAWNPEWKVPNQGIKDLKHRAGILAAQVY
GNVSDGLKVWGVTGTNGKTSITQWLAQAADLLGEKTAIIGTVGNGFWGAL
EETAHTTPAPVDVQTLLYRFRQQGATAAAMEVSSHGLDQSRVNGVPFRSA
IFTNLTRDHLDYHGTMEAYGAIKSRLFYWHGLKHAVINTDDGYGAELAGR
LKKDCPDLAVYSYGFSEHADIRITDFTASSDGMEAVFQTPWGEGKCRTRL
LGRFNAQNLAACIALLCANGYPLDKVLDVLAKIRPASGRMDCIMNSGKPL
VVVDYAHTPDALEKALSTLQEIKPQGAALWCVFGCGGNRDCGKRPLMGAA
AVQGADKVVVTSDNPRLENPHDIINDILPAVPAPECVEADRAAAIRYAVE
QAAANDIILIAGKGHENYQDVQGVKHRFSDLEIVGQALLTRK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCAGCAAGTTAAGCCCTTTGGCTGAAACCGGCATCCCGACCCTGTC
GTGTGCAAACGCGGCAGGGCGTTTGTTGCATTCAGACAGCCGCCAAATCA
AACAAGGCGATATTTTCGTTGCCTGTCCGGGCGAATATGCCGACGGACGC
AGTTATATCCCCGCCGCCGTTGCCAACGGCGCGGCTTTTGTTTTTTGGGA
CGACGACGGCAGATTCGCGTGGAATCCCGAATGGAAAGTCCCCAATCAAG
GCATCAAAGATTTGAAACACCGTGCCGGCATATTGGCGGCACAGGTTTAC
GGCAACGTTTCAGACGGTCTCAAAGTCTGGGGCGTAACCGGAACCAACGG
CAAAACCTCCATCACGCAATGGCTGGCGCAAGCCGCCGATTTGTTGGGCG
AAAAAACCGCCATTATCGGCACGGTCGGCAACGGCTTTTGGGGTGCATTG
GAAGAAACCGCGCACACCACCCCCGCCCCCGTCGATGTCCAAACCCTGCT
CTACCGTTTCCGTCAACAAGGCGCAACAGCCGCCGCGATGGAAGTTTCCA
GCCACGGCCTTGACCAGTCGCGAGTCAACGGCGTGCCGTTCCGCAGCGCA
ATCTTCACCAACCTCACCCGAGACCACCTCGACTACCACGGCACGATGGA
AGCCTACGGTGCTATCAAGTCGCGCCTGTTTTACTGGCACGGCTTGAAAC
ACGCCGTTATCAATACCGATGACGGATACGGCGCGGAACTCGCAGGTCGT
CTGAAAAAAGACTGTCCCGATTTAGCCGTTTACAGCTATGGTTTCAGCGA
ACACGCCGACATCCGCATTACCGACTTTACCGCCTCTTCAGACGGCATGG
AAGCAGTATTCCAAACCCCGTGGGGCGAAGGAAAATGCCGCACCCGCCTG
CTCGGACGGTTCAACGCGCAAAACCTCGCCGCCTGCATCGCCTTGCTTTG
TGCCAACGGTTATCCGCTTGATAAGGTATTGGATGTGCTGGCAAAAATCC
GTCCCGCTTCAGGGCGCATGGACTGCATCATGAACAGCGGCAAGCCCTTG
GTCGTTGTCGATTACGCCCACACGCCCGACGCATTGGAAAAAGCACTCTC
CACTTTGCAGGAAATCAAACCGCAGGGTGCGGCCTTATGGTGCGTATTCG
GTTGCGGCGGCAACCGCGATTGCGGCAAACGCCCATTGATGGGCGCGGCA
GCCGTACAGGGCGCGGATAAAGTCGTCGTAACCAGCGACAACCCGCGTTT
GGAAAATCCGCACGACATCATCAACGACATCCTGCCCGCCGTGCCCGCGC
CCGAATGCGTCGAAGCCGACCGCGCCGCCGCCATCCGTTATGCGGTTGAG
CAGGCCGCCGCAAACGACATCATCCTGATTGCCGGCAAAGGACACGAAAA
CTATCAGGATGTACAGGGCGTGAAGCACCGTTTTTCCGATCTTGAAATCG
TCGGGCAGGCTTTGTTAACTCGTAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy