Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1257 IGR1258 IGR1260 IGR1259 IGR1253 IGR1256 IGR1254 IGR1255 NG1538 ftsL, - NG1543 NG1536 NG1544 mraY, - NG1537 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1538 ftsL, - NG1543 NG1536 NG1544 mraY, - NG1537 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1538 NG1536 NG1544 mraY, - NG1537 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 ftsL, - NG1543
* Calculated from Protein Sequence

Gene ID: NG1540

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dca  

Definition:
phase variable gene (Dca)

Gene Start:
1513894

Gene Stop:
1512251

Gene Length:
1644

Molecular Weight*:
61152

pI*:
9.90

Net Charge*:
15.38

EC:
 

Functional Class:
Cellular processes; Transformation  

Pathway: pathway table

Primary Evidence:
Snyder,L.A., Saunders,N.J. and Shafer,W.M.,
A putatively phase variable gene (dca) required for natural
competence in Neisseria gonorrhoeae but not Neisseria meningitidis is located within the division cell wall (dcw) gene cluster,
J. Bacteriol. 183 (4), 1233-1241 (2001)

Comment:
Oklahoma ID: NGO.1540c

Blast Summary:  PSI-Blast Search
NG1540 is 99% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 6466123.
Residues 1-548 in NG1540 have 97% similarity to residues 1-548 in AF195059, N. meningitidis Dca.
Residues 66-532 in NG1540 have 33% similarity to residues 58-512 in U32781, H. influenzae Rd conserved hypothetical protein.


COGS Summary:  COGS Search
BeTs to 3 clades of COG2194
COG name: Predicted membrane-associated, metal-dependent hydrolase
Functional Class:  R
The phylogenetic pattern of COG2194 is --------E--HuJ------x
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB003371 (Integral membrane protein of unknown function) with a combined E-value of 8.6e-33.
    IPB003371A    235-258
    IPB003371B    295-309
    IPB003371C    350-379


ProDom Summary:  Protein Domain Search
Residues 243-386 are 42% similar to a (PROTEIN INTERGENIC REGION TRANSMEMBRANE) protein domain (PD005703) which is seen in YA64_HAEIN.

Residues 66-241 are 24% similar to a (PROTEIN TRANSMEMBRANE HI1005 OMPX-MOEB) protein domain (PD037751) which is seen in YA05_HAEIN.

Residues 396-500 are 43% similar to a (HYPOTHETICAL 59.7 KD PROTEIN) protein domain (PD091539) which is seen in YBIP_ECOLI.



Paralogs:  Local Blast Search


NG1540 is paralogously related to NG1198 (conserved hypothetical protein (possible outer membrane protein)) (2e-13) and NG1280 (conserved hypothetical protein) (3e-10).


Pfam Summary:  Pfam Search
Residues 230 to 518 (E-value = 3.9e-94) place NG1540 in the Sulfatase family which is described as Sulfatase (PF00884)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
33
cleavable N-terminal sequence  
1  
35
non-globular  
34  
132
transmembrane  
46  
62
transmembrane  
68  
84
transmembrane  
118  
134
transmembrane  
156  
172

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MKQSARIKNMDQTLKNTLGICALLAFCFGAAIASGYHLEYEYGYRYSAVG
ALASVVFLLLLARGFPRVSSVVLLIYVGTTALYLPVGWLYGAPSYQIVGS
ILESNPAEAREFVGNLPGSLYFVQALFFIFGLTVWKYCVSVGVFADVKNY
KRRSKIWLTILLTLILSCAVMEKIAGDKDWREPDAGLLLNIFDLYYDLAS
APAQYAAKRAHILEAAKKASTWHIRHVAPKYKNYVVVIGESARSDYMNVY
GFPLPDTPFLSRTKGLLINGYQSTAHATNLSLPQTLGLPGEPNNNIVSLA
KQAGFRTAWLSNQGMLGHFANEISTYALRSDYPWFTQRGDYGKSAGLSDR
LLLPAFKRVLTGNAGTKPRLIVMHLMGSHSDFCTRLDKDARRFQYQTEKI
SCYVSTIAQTDKFLEDTVKILNENKESWSLVYFSDHGLMHVGKGGERTLT
HGEWKRQSYGVPLVKISSDDTRREMIKVRRSAFNFLRGFGSWTGIETDEL
PDDGYDFWGNVPDVPGEGNNLAFIDRQSDDPAPWYAGKGKSAKNTSKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACAATCCGCCCGAATAAAAAATATGGATCAGACATTAAAAAATAC
ATTGGGCATTTGCGCGCTTTTAGCCTTTTGTTTTGGCGCGGCCATCGCAT
CAGGTTATCACTTGGAATATGAATACGGCTACCGTTATTCTGCCGTGGGC
GCTTTGGCTTCGGTTGTATTTTTATTATTATTGGCACGCGGCTTCCCGCG
CGTTTCTTCAGTTGTTTTACTGATTTACGTCGGCACAACCGCCCTATATT
TGCCGGTCGGCTGGCTGTATGGTGCGCCTTCTTATCAGATAGTCGGTTCG
ATATTGGAAAGCAATCCTGCCGAGGCGCGTGAATTTGTCGGCAATCTTCC
CGGGTCGCTTTATTTTGTGCAGGCATTATTTTTCATTTTTGGCTTGACAG
TTTGGAAATATTGTGTATCTGTGGGGGTATTTGCTGACGTAAAAAACTAT
AAACGTCGCAGCAAAATATGGCTGACCATATTATTGACTTTGATTTTGTC
CTGCGCGGTGATGGAGAAAATCGCTGGCGATAAAGATTGGCGAGAACCTG
ATGCCGGCCTGTTGTTGAATATTTTCGACCTGTATTACGATTTGGCTTCC
GCGCCGGCACAATATGCCGCCAAGCGCGCCCACATTTTGGAAGCAGCAAA
AAAAGCGTCAACATGGCATATCCGTCATGTTGCGCCCAAGTATAAAAATT
ATGTTGTGGTTATCGGTGAGAGCGCGCGTTCGGATTATATGAATGTTTAC
GGTTTCCCATTGCCCGATACGCCTTTTTTGAGTCGGACCAAAGGGCTGTT
GATAAACGGTTACCAATCGACCGCCCACGCGACGAATCTTTCGCTGCCGC
AGACTTTGGGGCTGCCGGGAGAGCCGAACAATAACATTGTCAGCTTGGCG
AAGCAGGCGGGTTTTCGGACGGCGTGGCTGTCTAATCAAGGAATGTTGGG
GCATTTTGCCAACGAAATTTCCACCTATGCCCTACGCAGCGATTATCCGT
GGTTTACCCAAAGGGGTGATTATGGCAAAAGCGCGGGGTTGAGCGACCGC
CTTTTGTTGCCGGCGTTCAAACGGGTTTTGACAGGAAATGCAGGCACGAA
GCCTCGGCTGATTGTGATGCACCTGATGGGTTCGCACAGTGATTTTTGCA
CACGTTTGGATAAGGATGCGCGGCGGTTTCAGTATCAAACTGAAAAAATA
TCCTGCTATGTTTCCACCATCGCGCAAACCGATAAATTTTTAGAAGATAC
GGTTAAGATATTGAATGAAAATAAAGAAAGCTGGTCTTTGGTTTACTTTT
CCGACCACGGTTTGATGCATGTCGGCAAAGGCGGCGAGCGAACGTTGACA
CACGGCGAGTGGAAGCGTCAAAGCTACGGCGTGCCGCTGGTTAAAATTTC
GTCCGATGACACGCGGCGCGAAATGATTAAAGTGAGGCGCAGCGCGTTTA
ATTTTTTACGCGGATTCGGCAGTTGGACGGGTATCGAAACCGACGAGTTG
CCCGATGACGGCTATGATTTTTGGGGGAATGTCCCCGATGTGCCGGGCGA
AGGCAATAACCTTGCCTTTATCGACAGACAGTCCGACGACCCCGCGCCGT
GGTATGCGGGAAAAGGCAAATCGGCTAAAAATACGTCTAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy