Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1257 IGR1258 IGR1253 IGR1256 IGR1254 IGR1252 IGR1255 NG1538 NG1536 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1538 NG1536 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542 NG1538 NG1536 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 pbp2,penA, - NG1542
* Calculated from Protein Sequence

Gene ID: NG1539

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murF  

Definition:
UDP-MurNAc-pentapeptide synthetase (MurF)

Gene Start:
1512123

Gene Stop:
1510768

Gene Length:
1356

Molecular Weight*:
47763

pI*:
4.90

Net Charge*:
-15.13

EC:
6.3.2.15  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Lysine biosynthesis
Peptideglycan biosynthesis

Secondary Evidence:
Eveland,S.S., Pompliano,D.L. and Anderson,M.S.
Conditionally lethal Escherichia coli murein mutants contain point
defects that map to regions conserved among murein and folyl
poly-gamma-glutamate ligases: identification of a ligase
superfamily
Biochemistry 36 (20), 6223-6229 (1997)
Medline: 97309380

Duncan,K., van Heijenoort,J. and Walsh,C.T.
Purification and characterization of the D-alanyl-D-alanine-adding
enzyme from Escherichia coli
Biochemistry 29 (9), 2379-2386 (1990)
Medline: 90248455

Yan,Y., Munshi,S., Leiting,B., Anderson,M.S., Chrzas,J. and Chen,Z.
Crystal structure of Escherichia coli UDPMurNAc-tripeptide
d-alanyl-d-alanine-adding enzyme (MurF) at 2.3 A resolution
J. Mol. Biol. 304 (3), 435-445 (2000)
Medline: 20545602


Comment:
Oklahoma ID: NGO.1539c

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG1533 (murG), NG1535 (murD), NG0394 (murB), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-452 in NG1539 have 94% similarity to residues 1-452 in AL162758, N. meningitidis Z2491 UDP-MurNAc-pentapeptide synthetase.
Residues 20-452 in NG1539 have 41% similarity to residues 21-454 in U32793, H. influenzae Rd UDP-MurNAc-pentapeptide synthetase (murF).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0770
COG name: UDP-N-acetylmuramyl pentapeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0770 is -mt--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 91-222 are 51% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001083) which is seen in MURF_HAEIN.

Residues 362-451 are 43% similar to a (UDP-MURNAC-PENTAPEPTIDE) protein domain (PD150911) which is seen in MURF_ECOLI.

Residues 253-361 are 37% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001216) which is seen in MURF_ECOLI.



Paralogs:  Local Blast Search


NG1539 is paralogously related to NG1535 (UDP-N-acetylmuramoylalanine--D-glutamate ligase (MurD)) (2e-12), NG1532 (UDP-N-acetylmuramate--alanine ligase (MurC)) (1e-08), NG0815 (UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase) (6e-08) and NG1541 (UDP-N-acetylmuramyl-tripeptide synthetase (MurE)) (1e-05).


Pfam Summary:  Pfam Search
Residues 36 to 307 (E-value = 2.7e-44) place NG1539 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 316 to 404 (E-value = 4.6e-16) place NG1539 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
37  
105
transmembrane  
52  
68
non-globular  
249  
342

PDB Hit:
pdb|1GG4|1GG4-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 250.0 3e-67
pdb|1E0D|1E0D-A UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE 41.8 3e-04
pdb|1UAG|1UAG UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE 39.5 0.001000
pdb|1GG4|1GG4-A CR

Gene Protein Sequence:
MKPLDLNFICQALKLPMPSENKPVSRIVTDSRDIREGDVFFALAGGRFDA
HDFVGGVLSAGAAAVVVSREDCAALGGALKVDDTLAALQTLAKAWRDNVN
PFVFGITGSGGKTTVKEMLAAVLRRRFGDDAVSATAGNFNNHIGLPLTLL
KLNEKHRYAVIEMGMNHFGELAVLTQIAKPDAALVNNALRAHVGCGFDGV
GDIAKAKSEIYAGLCSDGMALIPQEDANMAVFKTATFNLNTCTFGVDSGD
VRAENIVLKPLSCEFDLVCGDERTAVVLPVPGRHNVHNAAAAAALALAAG
LSLNDVAEGLQGFSNIKGRLNVKAGIKGATLIDDTYNANPDSMKAAVDVL
ARMPAPRIFVMGDMGELGEDEAAAMHAEVGAYARDQGIEAAYFVGDNSVE
AAEKFGADGLWFAAKDPLIQVLSHDLPERATVLVKGSRFMQMEEVVEALE
DK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACCACTGGACCTAAATTTCATCTGCCAAGCCCTCAAGCTTCCGAT
GCCGTCTGAAAACAAACCCGTGTCGCGCATCGTAACCGACAGCCGCGATA
TTCGGGAAGGCGATGTGTTTTTCGCATTGGCGGGCGGGCGGTTTGACGCG
CATGATTTTGTTGGAGGCGTATTGTCTGCGGGCGCGGCGGCGGTTGTGGT
TTCGCGCGAAGATTGCGCGGCTTTGGGCGGCGCGTTGAAAGTCGATGACA
CGCTTGCCGCGTTGCAAACGTTGGCGAAGGCGTGGCGCGATAATGTGAAC
CCGTTTGTGTTCGGCATTACCGGTTCGGGCGGCAAGACGACGGTGAAGGA
GATGCTGGCTGCGGTATTGCGCCGCCGTTTCGGCGATGATGCCGTTTCGG
CGACGGCAGGCAACTTCAACAACCACATCGGATTGCCGCTGACTTTATTG
AAATTAAACGAAAAACACCGCTATGCCGTGATTGAAATGGGCATGAACCA
TTTTGGCGAACTGGCGGTTTTAACGCAAATCGCCAAACCCGATGCCGCTT
TGGTCAACAACGCCCTGCGCGCCCATGTCGGATGCGGTTTCGACGGAGTG
GGCGATATTGCCAAAGCGAAAAGCGAGATTTATGCAGGCTTATGTTCAGA
CGGCATGGCACTGATTCCTCAAGAAGATGCCAATATGGCTGTCTTCAAAA
CGGCAACGTTTAATTTGAATACGTGCACTTTCGGCGTCGATAGCGGCGAT
GTCCGCGCGGAAAATATCGTGCTGAAACCTTTGTCGTGCGAATTTGATTT
GGTGTGCGGCGACGAGCGCACTGCCGTGGTGCTGCCTGTTCCCGGCCGCC
ACAATGTCCACAACGCCGCCGCTGCCGCCGCGCTGGCTTTGGCTGCCGGT
TTGAGTTTGAACGATGTGGCGGAAGGTTTGCAAGGCTTCAGCAACATCAA
AGGCCGTCTGAACGTCAAAGCCGGCATCAAGGGCGCAACCCTGATTGACG
ATACTTATAATGCGAATCCCGACAGTATGAAAGCCGCGGTTGACGTGTTG
GCGCGTATGCCTGCGCCGCGCATTTTCGTGATGGGCGATATGGGCGAACT
GGGCGAGGACGAAGCCGCCGCCATGCACGCCGAAGTCGGCGCGTACGCCC
GCGACCAAGGCATCGAAGCGGCTTATTTTGTCGGCGACAACAGCGTCGAA
GCGGCGGAAAAATTTGGCGCGGACGGTTTGTGGTTCGCCGCCAAAGACCC
GTTGATTCAAGTGTTGAGCCACGATTTGCCCGAACGCGCCACCGTGTTGG
TGAAAGGTTCGCGCTTTATGCAGATGGAAGAAGTGGTCGAGGCATTGGAG
GATAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy