Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1251 IGR1257 IGR1250 IGR1253 IGR1256 IGR1254 IGR1252 IGR1255 NG1538 NG1536 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 NG1538 NG1536 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540 NG1538 NG1536 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murE, - NG1541 dca, - NG1540
* Calculated from Protein Sequence

Gene ID: NG1537

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mraY  

Definition:
phopho-N-acetylmuramoyl-pentapeptide-transferase (MraY)

Gene Start:
1510341

Gene Stop:
1509262

Gene Length:
1080

Molecular Weight*:
39333

pI*:
10.30

Net Charge*:
12.23

EC:
2.7.8.13  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Peptideglycan biosynthesis

Secondary Evidence:
Geis,A. and Plapp,R.
Phospho-N-acetylmuramoyl-pentapeptide-transferase of Escherichia
coli K12. Properties of the membrane-bound and the extracted and
partially purified enzyme
Biochim. Biophys. Acta 527 (2), 414-424 (1978)
M:79082893

Ikeda,M., Wachi,M., Jung,H.K., Ishino,F. and Matsuhashi,M.
The Escherichia coli mraY gene encoding
UDP-N-acetylmuramoyl-pentapeptide: undecaprenyl-phosphate
phospho-N-acetylmuramoyl-pentapeptide transferase
J. Bacteriol. 173 (3), 1021-1026 (1991)
M:91123172

Bouhss,A., Mengin-Lecreulx,D., Le Beller,D. and Van Heijenoort,J.
Topological analysis of the MraY protein catalysing the first
membrane step of peptidoglycan synthesis
Mol. Microbiol. 34 (3), 576-585 (1999)
M:20032370


Comment:
Oklahoma ID: NGO.1537c

Blast Summary:  PSI-Blast Search
Residues 1-360 in NG1537 have 98% similarity to residues 1-360 in AL162758, N. meningitidis Z2491 phopho-N-acetylmuramoyl-pentapeptide-transferase.
Residues 1-360 in NG1537 have 58% similarity to residues 1-360 in U32793, H. influenzae Rd phospho-N-acetylmuramoyl-pentapeptide-transferase E (mraY).


COGS Summary:  COGS Search
BeTs to 15 clades of COG0472
COG name: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase
Functional Class:  M
The phylogenetic pattern of COG0472 is -mTkyQVCEBRHUJ--olinX
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003524 (Phospho-N-acetylmuramoyl-pentapeptide-transferase) with a combined E-value of 2.6e-116.
    IPB003524A    16-29
    IPB003524B    64-95
    IPB003524C    102-140
    IPB003524D    184-201
    IPB003524E    245-278
    IPB003524F    279-313
    IPB003524G    314-346


ProDom Summary:  Protein Domain Search
Residues 228-345 are 61% similar to a (TRANSFERASE TRANSMEMBRANE) protein domain (PD001416) which is seen in MRAY_HAEIN.

Residues 145-214 are 52% similar to a (TRANSFERASE TRANSMEMBRANE) protein domain (PD002130) which is seen in MRAY_HAEIN.

Residues 28-122 are 54% similar to a (TRANSFERASE TRANSMEMBRANE) protein domain (PD002261) which is seen in MRAY_HAEIN.



Paralogs:  Local Blast Search


NG1537 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 97 to 290 (E-value = 4.2e-55) place NG1537 in the Glycos_transf_4 family which is described as Glycosyl transferase (PF00953)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
23  
39
non-globular  
58  
309
transmembrane  
72  
88
transmembrane  
96  
112
transmembrane  
139  
155
transmembrane  
169  
185
transmembrane  
200  
216
transmembrane  
239  
255
transmembrane  
268  
284
transmembrane  
288  
304
transmembrane  
338  
354

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MFLWLAHFSNWLTGLNIFQYTTFRAVMAALTALAFSLMFGPWTIRRLTAL
KCGQAVRTDGPQTHLVKNGTPTMGGSLILTAITVSTLLWGNWANPYIWIL
LGVLLATGALGFYDDWRKVVYKDPNGVSAKFKMVWQSSVAVIAGLALFYL
AANSANNILIVPFFKQIALPLGVVGFLVLSYLTIVGTSNAVNLTDGLDGL
AAFPVVLVAAGLAIFAYVSGHYQFSQYLQLPYVAGANEVAIFCTAMCGAC
LGFLWFNAYPAQVFMGDVGALALGAALGTVAVIVRQEFVLVIMGGLFVVE
AVSVMLQVGWYKKTKKRIFLMAPIHHHYEQKGWKETQVVVRFWIITIVLV
LIGLSTLKIR

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTTATGGCTCGCACATTTCAGCAACTGGTTAACCGGTCTGAATAT
TTTTCAATACACCACATTCCGCGCCGTTATGGCGGCGTTGACCGCCTTGG
CGTTTTCCCTGATGTTCGGCCCGTGGACGATACGCAGGCTGACCGCGCTC
AAATGCGGGCAGGCAGTGCGTACCGACGGCCCGCAAACCCACCTCGTCAA
AAACGGCACGCCGACGATGGGCGGTTCGCTGATTCTGACCGCCATTACCG
TGTCCACCCTGTTGTGGGGCAACTGGGCGAACCCGTATATCTGGATTCTC
TTGGGCGTACTGCTTGCCACCGGTGCGCTCGGTTTTTACGACGACTGGCG
CAAAGTCGTTTATAAAGACCCCAACGGCGTGTCCGCCAAATTCAAAATGG
TGTGGCAGTCAAGCGTTGCCGTTATCGCCGGTTTGGCATTGTTTTACCTT
GCCGCCAATTCCGCCAACAATATTTTGATTGTCCCGTTTTTCAAACAAAT
CGCCCTGCCGCTGGGCGTGGTCGGCTTTTTGGTGTTGTCTTACCTGACCA
TCGTCGGCACATCCAACGCCGTCAACCTCACCGACGGCTTGGACGGCCTT
GCCGCCTTCCCCGTCGTCCTCGTTGCCGCCGGGCTCGCCATTTTCGCCTA
CGTCAGCGGACACTACCAATTTTCCCAATACCTCCAGCTTCCCTATGTCG
CCGGCGCGAACGAAGTCGCTATATTCTGCACCGCCATGTGCGGCGCGTGC
CTCGGATTTTTGTGGTTCAACGCCTATCCCGCGCAAGTCTTTATGGGCGA
TGTCGGCGCGCTGGCATTGGGTGCCGCGCTCGGTACCGTTGCCGTCATCG
TCCGCCAAGAATTTGTCCTCGTCATTATGGGCGGTCTGTTCGTCGTAGAA
GCCGTGTCCGTTATGCTTCAGGTCGGCTGGTACAAGAAAACCAAAAAACG
CATCTTCCTGATGGCGCCGATTCATCACCATTACGAACAAAAAGGCTGGA
AAGAAACCCAAGTCGTCGTCCGTTTCTGGATTATTACCATCGTCTTGGTA
TTGATCGGTTTGAGTACCCTCAAAATTCGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy