Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1251 IGR1250 IGR1253 IGR1249 IGR1256 IGR1254 IGR1252 IGR1255 NG1538 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murC, - NG1532 dca, - NG1540 NG1538 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murC, - NG1532 dca, - NG1540 NG1538 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsW, - NG1534 murD, - NG1535 murF, - NG1539 murC, - NG1532 dca, - NG1540
* Calculated from Protein Sequence

Gene ID: NG1535

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murD  

Definition:
UDP-N-acetylmuramoylalanine--D-glutamate ligase (MurD)

Gene Start:
1508669

Gene Stop:
1507335

Gene Length:
1335

Molecular Weight*:
48023

pI*:
5.00

Net Charge*:
-12.65

EC:
6.3.2.9  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Glutamine and D-glutamate metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Ikeda,M., Wachi,M., Ishino,F. and Matsuhashi,M.
Nucleotide sequence involving murD and an open reading frame ORF-Y
spacing murF and ftsW in Escherichia coli
Nucleic Acids Res. 18 (4), 1058 (1990)
Medline: 90192099

Mengin-Lecreulx,D. and van Heijenoort,J.
Nucleotide sequence of the murD gene encoding the
UDP-MurNAc-L-Ala-D-Glu synthetase of Escherichia coli
Nucleic Acids Res. 18 (1), 183 (1990)
Medline: 90174916

Pratviel-Sosa,F., Mengin-Lecreulx,D. and van Heijenoort,J.
Over-production, purification and properties of the uridine
diphosphate N-acetylmuramoyl-L-alanine:D-glutamate ligase from
Escherichia coli
Eur. J. Biochem. 202 (3), 1169-1176 (1991)
Medline: 92111492

Bertrand,J.A., Auger,G., Fanchon,E., Martin,L., Blanot,D., van
Heijenoort,J. and Dideberg,O.
Crystal structure of UDP-N-acetylmuramoyl-L-alanine:D-glutamate
ligase from Escherichia coli
EMBO J. 16 (12), 3416-3425 (1997)
Medline: 97361823



Comment:
Oklahoma ID: NGO.1535c

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG1533 (murG), NG0394 (murB), NG1539 (murF), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-445 in NG1535 have 95% similarity to residues 1-445 in AL162758, N. meningitidis Z2491 UDP-N-acetylmuramoylalanine--D-glutamate ligase.
Residues 3-445 in NG1535 have 36% similarity to residues 4-437 in X17609, E. coli UDP-N-acetylmuramoyl-L-alanine:D-gluta ligase (AA 1-438).


COGS Summary:  COGS Search
BeTs to 12 clades of COG0771
COG name: UDP-N-acetylmuramoylalanine-D-glutamate ligase
Functional Class:  M
The phylogenetic pattern of COG0771 is --T--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-223 are 34% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001083) which is seen in MURD_HAEIN.

Residues 350-438 are 43% similar to a (LIGASE) protein domain (PD039274) which is seen in O84763_CHLTR.

Residues 260-341 are 40% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001216) which is seen in MURD_HAEIN.



Paralogs:  Local Blast Search


NG1535 is paralogously related to NG1532 (UDP-N-acetylmuramate--alanine ligase (MurC)) (2e-18), NG1539 (UDP-MurNAc-pentapeptide synthetase (MurF)) (2e-12), NG1541 (UDP-N-acetylmuramyl-tripeptide synthetase (MurE)) (3e-10) and NG0815 (UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase) (1e-09).


Pfam Summary:  Pfam Search
Residues 43 to 298 (E-value = 4.7e-41) place NG1535 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 307 to 385 (E-value = 2.9e-14) place NG1535 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
33
transmembrane  
8  
24

PDB Hit:
pdb|1E0D|1E0D-A UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE 245.0 1e-65
pdb|1UAG|1UAG UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE LIGASE243.0 4e-65
pdb|1GG4|1GG4-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 89.3 1e-18
pdb|1J6U|1J6U-A CRYS

Gene Protein Sequence:
MTFQNKKILVAGLGGTGISMIAYLRKNGAEVAAYDAELKAERVAQIGKMF
DGLVFYTGRLKDALDNGFDILALSPGISERQPDIEAFKQNGGRVLGDIEL
LADIVNRRGDKVIAITGSNGKTTVTSLVGYLCIKCGLDTVIAGNIGTPVL
EAELQREGKKADVWVLELSSFQLENTESLRPTAATVMNISEDHLDRYDDL
LDYAHTKAEIFRGDGVQVLNADDVFCRAMKRAGREVKRFSLEHEADFWLE
RGTGCLKQGNEDLISTQDIPLQGLHNAANVMAAVALCEAVGLPREALLEH
VKTFQGLPHRVEKIGEKNGVVFIDDSKGTNVGATAAAIAGLQNPLFVILG
GMGKGQDFTPLRDALKDKAKGVFLIGVDAPQIRRDLDGCGLNLTDCVTLE
EAVQTAYAQAEAGDIVLLSPACASFDMFKGYAHRSEVFIEAFKAL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTTTCCAAAACAAAAAAATCCTCGTCGCCGGACTTGGCGGCACGGG
TATTTCCATGATTGCCTATCTGCGCAAAAACGGCGCGGAGGTTGCCGCTT
ATGATGCGGAGCTGAAAGCCGAGCGCGTGGCGCAAATCGGTAAGATGTTT
GACGGGCTGGTGTTTTACACGGGTCGTCTGAAAGATGCGTTGGACAACGG
TTTCGATATTCTGGCGCTCAGTCCCGGCATCAGCGAGCGGCAGCCGGATA
TCGAGGCGTTCAAGCAAAACGGCGGGCGCGTGCTAGGCGACATCGAATTG
CTGGCGGACATTGTGAACCGCCGCGGCGACAAGGTGATTGCGATTACCGG
CAGCAACGGCAAAACCACGGTAACGAGCCTGGTCGGCTATCTCTGCATCA
AGTGCGGGCTGGATACCGTCATTGCGGGCAATATCGGTACGCCGGTTTTG
GAGGCAGAATTGCAGCGCGAAGGCAAAAAGGCGGACGTGTGGGTGTTGGA
GCTTTCCAGCTTCCAACTGGAAAACACCGAAAGCCTGCGCCCGACTGCGG
CGACGGTGATGAACATTTCCGAAGACCATCTCGACCGCTACGACGATTTG
CTCGACTACGCGCATACCAAAGCCGAGATTTTCCGTGGCGATGGAGTGCA
GGTTTTGAATGCGGACGACGTGTTCTGCCGCGCCATGAAACGGGCAGGGC
GTGAAGTGAAACGGTTTTCCTTGGAACACGAAGCCGATTTTTGGTTGGAA
CGCGGGACGGGCTGTTTAAAACAAGGCAATGAAGATTTGATTTCTACGCA
AGACATCCCGCTGCAAGGTTTGCACAACGCCGCCAACGTTATGGCTGCCG
TGGCTTTGTGCGAGGCCGTCGGTTTGCCGCGCGAAGCATTGCTGGAACAC
GTCAAAACCTTCCAAGGCTTGCCGCACCGTGTGGAAAAAATCGGCGAGAA
AAACGGCGTGGTATTCATCGACGACAGCAAAGGCACGAATGTCGGCGCGA
CCGCCGCCGCGATTGCCGGTTTGCAAAACCCGCTCTTCGTGATTTTGGGC
GGCATGGGCAAAGGGCAGGACTTCACGCCCCTGCGCGACGCGTTGAAAGA
TAAGGCAAAAGGCGTGTTCCTGATCGGCGTCGATGCGCCGCAAATCCGCC
GCGATTTGGACGGCTGCGGCTTGAACCTGACCGACTGCGTCACTTTGGAA
GAGGCGGTTCAGACGGCATACGCCCAAGCCGAAGCGGGCGATATTGTCTT
GCTCAGCCCCGCCTGCGCGAGTTTCGATATGTTTAAAGGCTACGCGCACC
GTTCGGAAGTGTTTATCGAAGCGTTTAAGGCTTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy