Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1251 IGR1250 IGR1253 IGR1248 IGR1249 IGR1254 IGR1252 IGR1255 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 NG1536 ddlB, - NG1531 murG, - NG1533 mraY, - NG1537 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 ftsQ, - NG1530 ftsQ, - NG1530
* Calculated from Protein Sequence

Gene ID: NG1533

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murG  

Definition:
UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol

Gene Start:
1505878

Gene Stop:
1504814

Gene Length:
1065

Molecular Weight*:
38270

pI*:
9.80

Net Charge*:
10.42

EC:
2.4.1.-  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Blood group glycolipid biosynthesis - lact series
Blood group glycolipid biosynthesis - neolact series
Fructose and mannose metabolism
Glycerolipid metabolism
Glycoprotein biosynthesis
Peptideglycan biosynthesis
Sphingoglycolipid metabolism

Secondary Evidence:
Mengin-Lecreulx,D., Texier,L. and van Heijenoort,J.
Nucleotide sequence of the cell-envelope murG gene of Escherichia
coli
Nucleic Acids Res. 18 (9), 2810 (1990)
Medline: 90251461

Mengin-Lecreulx,D., Texier,L., Rousseau,M. and van Heijenoort,J.
The murG gene of Escherichia coli codes for the
UDP-N-acetylglucosamine: N-acetylmuramyl-(pentapeptide)
pyrophosphoryl-undecaprenol N-acetylglucosamine transferase
involved in the membrane steps of peptidoglycan synthesis
J. Bacteriol. 173 (15), 4625-4636 (1991)
Medline: 91310568

Bupp,K. and van Heijenoort,J.
The final step of peptidoglycan subunit assembly in Escherichia
coli occurs in the cytoplasm
J. Bacteriol. 175 (6), 1841-1843 (1993)
Medline: 93194811



Comment:
Oklahoma ID: NGO.1533c

For other 'mur' genes, see NG1500 (murI), NG1532 (murC), NG0394 (murB), NG1535 (murD), NG1539 (murF), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-346 in NG1533 have 97% similarity to residues 1-346 in AE002398, N. meningitidis MC58 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase.
Residues 4-351 in NG1533 have 45% similarity to residues 6-348 in AE006049, P. multocida MurG.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0707
COG name: UDP-glucuronosyltransferases
Functional Class:  M
The phylogenetic pattern of COG0707 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-86 are 48% similar to a (TRANSFERASE N-ACETYLGLUCOSAMINE) protein domain (PD006119) which is seen in MURG_HAEIN.

Residues 6-325 are 28% similar to a (TRANSFERASE PEPTIDOGLYCAN SYNTHESIS MURG) protein domain (PD089845) which is seen in Q9ZK59_BBBBB.

Residues 117-235 are 46% similar to a (TRANSFERASE N-ACETYLGLUCOSAMINE) protein domain (PD005948) which is seen in MURG_ECOLI.



Paralogs:  Local Blast Search


NG1533 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 6 to 144 (E-value = 1.2e-46) place NG1533 in the Glyco_transf_28 family which is described as Glycosyltransferase family 28 N-terminal domain (PF03033)
Residues 183 to 346 (E-value = 9e-40) place NG1533 in the Glyco_tran_28_C family which is described as Glycosyltransferase family 28 C-terminal domain (PF04101)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
96  
112
transmembrane  
263  
279

PDB Hit:
pdb|1F0K|1F0K-A THE 1.9 ANGSTROM CRYSTAL STRUCTURE OF E. COLI 272.0 1e-73

Gene Protein Sequence:
MGGKTFMLMAGGTGGHIFPALAVADSLRVRGHHVIWLGSKDSMEERIVPQ
YGIRLETLAIKGIRGNGIKRKLMLPFTLYKTVREAQRIIRKHRVECVIGF
GGFVTFPGGLAAKLLGVPIVIHEQNAVAGLSNRHLSRWAKRVLYAFPKAF
SHEGGLVGNPVRADISNLPVPAERFQGREGRLKILVVGGSLGADVLNKTV
PQALALLPEEVRPQMYHQSGRNKLGNLQADYDALGVKAECVEFITDMVSA
YRDADLVICRAGALTIAELTAAGLGALLVPYPHAVDDHQTANARFMVQAE
AGLLLPQTQLTAEKLAEILGSLNREKCLKWAENARTLALPHSADDVAEAA
IACAA

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGCGGTAAAACCTTTATGCTGATGGCGGGCGGAACGGGCGGACACAT
TTTCCCAGCTCTGGCTGTGGCGGATTCATTGCGCGTGCGCGGTCATCATG
TAATTTGGCTGGGCAGCAAGGATTCGATGGAAGAGCGCATCGTGCCGCAA
TACGGCATACGCTTGGAAACGCTGGCGATTAAAGGAATACGCGGCAACGG
CATCAAACGCAAGCTGATGCTTCCGTTTACTCTGTACAAAACCGTCCGCG
AAGCGCAGCGGATTATCCGCAAACACCGTGTCGAGTGCGTCATCGGCTTC
GGCGGTTTTGTTACCTTTCCCGGCGGTCTGGCGGCGAAACTCTTGGGCGT
GCCGATTGTGATTCACGAGCAAAACGCCGTGGCAGGCTTGTCCAACCGCC
ACCTGTCGCGCTGGGCGAAACGGGTGTTGTACGCTTTTCCGAAAGCGTTC
AGCCACGAAGGCGGTTTGGTCGGCAACCCCGTCCGCGCCGATATTAGCAA
CCTGCCCGTGCCTGCCGAACGCTTCCAAGGGCGCGAAGGCCGTCTGAAAA
TTTTGGTGGTCGGCGGCAGTTTGGGTGCGGACGTTTTGAACAAAACCGTA
CCGCAGGCGTTGGCACTGCTGCCTGAAGAGGTGCGCCCGCAGATGTACCA
CCAGTCGGGGCGTAACAAGCTGGGCAATCTTCAGGCGGATTATGACGCGT
TGGGCGTGAAAGCGGAATGCGTGGAATTTATTACCGACATGGTGTCCGCC
TACCGTGATGCCGATTTGGTGATTTGCCGTGCCGGCGCGCTGACGATTGC
CGAGTTGACGGCGGCGGGGCTGGGCGCGTTGTTAGTGCCGTATCCTCACG
CCGTTGATGACCATCAAACCGCCAACGCGCGTTTCATGGTGCAGGCAGAA
GCGGGGCTGCTGTTGCCGCAAACCCAGTTGACGGCGGAAAAACTCGCCGA
AATCCTCGGCAGCCTCAACCGCGAAAAATGCCTCAAATGGGCGGAAAACG
CCCGTACGTTGGCATTGCCGCACAGCGCGGATGACGTTGCCGAAGCCGCG
ATTGCGTGTGCGGCG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy