Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1251 IGR1250 IGR1253 IGR1248 IGR1249 IGR1247 IGR1252 NG1536 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 NG1536 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 NG1536 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 murD, - NG1535 murC, - NG1532 ftsQ, - NG1530 ftsQ, - NG1530
* Calculated from Protein Sequence

Gene ID: NG1532

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murC  

Definition:
UDP-N-acetylmuramate--alanine ligase (MurC)

Gene Start:
1504767

Gene Stop:
1503250

Gene Length:
1518

Molecular Weight*:
54829

pI*:
6.80

Net Charge*:
-1.78

EC:
6.3.2.8  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Glutamine and D-glutamate metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Eveland,S.S., Pompliano,D.L. and Anderson,M.S.
Conditionally lethal Escherichia coli murein mutants contain point
defects that map to regions conserved among murein and folyl
poly-gamma-glutamate ligases: identification of a ligase
superfamily
Biochemistry 36 (20), 6223-6229 (1997)
Medline: 97309380

Liger,D., Masson,A., Blanot,D., van Heijenoort,J. and Parquet,C.
Over-production, purification and properties of the
uridine-diphosphate-N-acetylmuramate:L-alanine ligase from
Escherichia coli
Eur. J. Biochem. 230 (1), 80-87 (1995)
Medline: 95324553


Comment:
Oklahoma ID: NGO.1532c

For other 'mur' genes, see NG1500 (murI), NG0394 (murB), NG1533 (murG), NG1535 (murD), NG1539 (murF), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-506 in NG1532 have 96% similarity to residues 1-506 in AL162758, N. meningitidis Z2491 UDP-N-acetylmuramate--alanine ligase.
Residues 42-501 in NG1532 have 57% similarity to residues 21-475 in AF306766, P. aeruginosa UDP-N-acetylmuramate:L-alanine ligase MurC.
Residues 46-495 in NG1532 have 54% similarity to residues 18-463 AE003919, X. fastidiosa UDP-N-acetylmuramate--alanine ligase.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0773
COG name: UDP-N-acetylmuramate-alanine ligase
Functional Class:  M
The phylogenetic pattern of COG0773 is -----qvcEbrHuj--olinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001645 (Folylpolyglutamate synthetase) with a combined E-value of 7.5e-06.
    IPB001645A    145-169


ProDom Summary:  Protein Domain Search
Residues 49-282 are 52% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001083) which is seen in MURC_ECOLI.

Residues 312-458 are 52% similar to a (LIGASE SYNTHETASE PEPTIDOGLYCAN SYNTHESIS CELL ENZYME) protein domain (PD001216) which is seen in MURC_HAEIN.



Paralogs:  Local Blast Search


NG1532 is paralogously related to NG0815 (UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase) (2e-36), NG1535 (UDP-N-acetylmuramoylalanine--D-glutamate ligase (MurD)) (2e-18) and NG1539 (UDP-MurNAc-pentapeptide synthetase (MurF)) (1e-08).


Pfam Summary:  Pfam Search
Residues 79 to 343 (E-value = 4.2e-60) place NG1532 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 352 to 446 (E-value = 1.3e-23) place NG1532 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
121  
190
transmembrane  
326  
342

PDB Hit:
pdb|1J6U|1J6U-A CRYSTAL STRUCTURE OF 164.0 2e-41
pdb|1GG4|1GG4-A CRYSTAL STRUCTURE OF ESCHERICHIA COLI 54.7 4e-08
pdb|1E0D|1E0D-A UDP-N-ACETYLMURAMOYL-L-ALANINE:D-GLUTAMATE 50.0 1e-06
pdb|1UAG|1UAG UDP-N

Gene Protein Sequence:
MFFISIRYIFVRKLWCANGQTFKITPLRTKNQPERNIMMKNRVSNIHFVG
IGGVGMSGIAEVLHNLGFKVSGSDQARNAATEHLSSLGIQVYPGHTAEHV
NGADVVVASTAVKKENPEVVAALERQIPVIPRALMLAELMRFRDGIAIAG
THGKTTTTSLTASILGAAGLDPTFVIGGKLNAAGTNARLGKGEYIVAEAD
ESDASFLHLTPIMSVVTNIDEDHMDTYGHSVEKLHQAFIDFIHRMPFYGK
AFLCVDSEHVRAILPKVSKPYATYGLDDTADIYATDIENVGAQMKFTVHV
QMKGHEQGSFEVVLNMPGRHNVLNALAAIGVALEVGASVEAIQKGLLGFE
GVGRRFQKYGDIKLPNGGTALLVDDYGHHPVEMAATLAAARGAYPEKRLV
LAFQPHRYTRTRDLFEDFTKVLNTVDALVLTEVYAAGEEPVAAADSRALA
RAIRVLGKLEPIYCENVADLPQMLMNVLQDGDVVLNMGAGSINRVPSALL
ELSKQI

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTTTATTTCAATCCGCTATATATTTGTCAGAAAACTATGGTGCGC
AAACGGTCAGACCTTTAAAATAACGCCTTTACGCACTAAAAACCAACCGG
AACGCAACATTATGATGAAAAATCGAGTAAGCAACATCCATTTTGTCGGT
ATCGGCGGCGTCGGCATGAGCGGTATCGCCGAAGTCTTGCACAATTTGGG
CTTTAAAGTTTCCGGTTCGGATCAGGCGCGAAATGCCGCTACCGAGCATT
TGAGCAGCCTGGGCATTCAAGTTTATCCCGGCCATACCGCAGAACACGTT
AACGGTGCGGATGTCGTCGTTGCCTCTACCGCCGTCAAGAAAGAAAATCC
CGAAGTTGTCGCTGCGTTGGAGCGGCAAATTCCCGTTATTCCGCGCGCCT
TGATGCTGGCAGAGCTGATGCGCTTCCGTGACGGCATCGCCATTGCCGGT
ACGCACGGCAAAACCACGACCACCAGCCTGACCGCCTCCATCCTCGGCGC
GGCAGGACTCGACCCCACTTTCGTTATCGGCGGCAAACTCAACGCCGCAG
GCACCAACGCCCGCTTGGGCAAAGGCGAATACATCGTTGCCGAAGCCGAC
GAATCCGATGCCTCTTTCCTACATCTGACCCCGATTATGTCCGTCGTTAC
CAATATCGACGAAGACCATATGGATACCTACGGGCACAGCGTCGAAAAAC
TGCATCAGGCGTTTATCGATTTCATCCACCGTATGCCCTTCTACGGCAAA
GCCTTTTTGTGTGTTGACAGCGAACACGTCCGCGCGATTTTGCCCAAAGT
GAGCAAACCTTATGCTACTTACGGTTTGGACGATACCGCCGACATCTACG
CCACCGACATCGAAAACGTCGGCGCGCAAATGAAATTCACCGTCCATGTT
CAAATGAAAGGACATGAGCAGGGGTCGTTTGAAGTCGTGCTGAATATGCC
CGGCAGACACAACGTGCTGAACGCATTGGCAGCCATCGGCGTGGCGCTGG
AAGTCGGCGCATCGGTTGAAGCGATCCAAAAAGGCTTGCTCGGCTTTGAA
GGCGTCGGCCGCCGCTTCCAAAAATACGGCGACATCAAGTTGCCAAACGG
CGGGACCGCTTTGCTGGTGGACGATTACGGACACCACCCCGTCGAAATGG
CGGCAACCCTTGCCGCTGCACGCGGCGCGTATCCGGAAAAACGTTTGGTG
CTCGCCTTCCAGCCGCACCGCTATACCCGCACGCGCGATTTGTTTGAAGA
CTTTACCAAAGTACTCAATACCGTTGATGCGCTGGTACTGACCGAAGTTT
ATGCCGCCGGCGAAGAGCCGGTTGCCGCCGCCGACTCCCGCGCCTTGGCG
CGTGCTATCCGCGTATTGGGCAAACTTGAGCCGATTTACTGCGAAAACGT
CGCCGACCTGCCGCAAATGCTGATGAATGTTTTACAGGATGGCGATGTTG
TGTTGAATATGGGTGCGGGAAGCATCAACCGCGTTCCCTCCGCGCTGTTG
GAATTGTCGAAACAGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy