Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1251 IGR1250 IGR1248 IGR1249 IGR1247 IGR1246 IGR1252 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 NG1527 murD, - NG1535 murC, - NG1532 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 NG1527 murD, - NG1535 murC, - NG1532 ddlB, - NG1531 murG, - NG1533 ftsZ, - NG1528 ftsA, - NG1529 ftsW, - NG1534 NG1527 murD, - NG1535 murC, - NG1532 ftsQ, - NG1530 ftsQ, - NG1530
* Calculated from Protein Sequence

Gene ID: NG1531

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ddlB  

Definition:
D-alanine--D-alanine ligase (DdlB)

Gene Start:
1503135

Gene Stop:
1502224

Gene Length:
912

Molecular Weight*:
32665

pI*:
4.70

Net Charge*:
-14.01

EC:
6.3.2.4  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Alanine metabolism
Glycerolipid metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Ikeda,M., Wachi,M., Jung,H.K., Ishino,F. and Matsuhashi,M.
Nucleotide sequence involving murG and murC in the mra gene cluster region of Escherichia coli
Nucleic Acids Res. 18 (13), 4014 (1990)
M:90326550

al-Bar,O.A., O'Connor,C.D., Giles,I.G. and Akhtar,M.
D-alanine: D-alanine ligase of Escherichia coli. Expression,
purification and inhibitory studies on the cloned enzyme
Biochem. J. 282 (Pt 3), 747-752 (1992)
M:92207163

Fan,C., Moews,P.C., Walsh,C.T. and Knox,J.R.
Vancomycin resistance: structure of D-alanine:D-alanine ligase at
2.3 A resolution
Science 266 (5184), 439-443 (1994)
M:95025939

Fan,C., Park,I.S., Walsh,C.T. and Knox,J.R.
D-alanine:D-alanine ligase: phosphonate and phosphinate
intermediates with wild type and the Y216F mutant
Biochemistry 36 (9), 2531-2538 (1997)
M:97207065


Comment:
Oklahoma ID: NGO.1531c

Blast Summary:  PSI-Blast Search
Residues 1-304 in NG1531 have 97% similarity to residues 1-204 in AL162758, N. meningitidis Z2491 D-alanine--D-alanine ligase B.
Residues 6-299 in NG1531 have 49% similarity to residues 7-303 in U32794, H. influenzae Rd D-alanine--D-alanine ligase (ddlB).
Residues 6-299 in NG1531 have 49% similarity to residues 9-305 in AE006049, P. multocida DdlB.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1181
COG name: D-alanine-D-alanine ligase and related ATP-grasp enzymes
Functional Class:  M
The phylogenetic pattern of COG1181 is -----qvcEbrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000291 (D-alanine--D-alanine ligase) with a combined E-value of 2.9e-78.
    IPB000291A    9-32
    IPB000291B    58-95
    IPB000291C    134-171
    IPB000291D    204-213
    IPB000291E    221-256
    IPB000291F    264-274


ProDom Summary:  Protein Domain Search
Residues 6-52 are 57% similar to a (D-ALANINE--D-ALANINE LIGASE D-ALANYLALANINE SYNTHETASE) protein domain (PD003517) which is seen in DDLB_ECOLI.

Residues 6-299 are 46% similar to a (LIGASE SYNTHETASE CARBOXYLASE CARBAMOYL-PHOSPHATE) protein domain (PD000180) which is seen in DDL_HAEIN.



Paralogs:  Local Blast Search


NG1531 is paralogously related to NG0048 (carbamoyl phosphate synthase large subunit (CarB)) (1e-08) and NG0044 (acetyl-CoA carboxylase/biotin carboxylase chain) (2e-04).


Pfam Summary:  Pfam Search
Residues 5 to 299 (E-value = 2.7e-110) place NG1531 in the Dala_Dala_ligas family which is described as D-ala D-ala ligase (PF01820)

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
41

PDB Hit:
pdb|1IOV|1IOV COMPLEX OF D-ALA:D-ALA LIGASE WITH ADP AND A 250.0 2e-67
pdb|1IOW|1IOW COMPLEX OF Y216F D-ALA:D-ALA LIGASE WITH ADP AND 249.0 7e-67
pdb|1E4E|1E4E-A D-ALANYL-D-LACATE LIGASE 115.0 8e-27
pdb|1E4E|1E4E-B D-AL

Gene Protein Sequence:
MQNFGKVAVLMGGFSSEREISLDSGTAILNALKSKGIDAYAFDPKETPLS
ELKERGFQTAFNILHGTYGEDGAVQGALELLGIPYTGSGVAASAIGMDKY
RCKLIWQALGLPVPEFAVLYDDTDFDAVEEKLGLPMFVKPAAEGSSVGVV
KVKEKGRLKSVYEELKHLQGEIIAERFIGGGEYSCPVLNGKGLPGIHIIP
ATEFYDYEAKYNRDDTIYQCPSEDLTEAEESLMRELAVRGAQAIGAEGCV
RVDFLKDTDGKLYLLEINTLPGMTGHSLVPKSAAVTGVGFADLCIEILKA
AHVG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGAATTTTGGCAAAGTGGCCGTATTGATGGGTGGTTTTTCCAGCGA
ACGAGAAATCTCGCTGGACAGCGGTACCGCCATTTTGAACGCCTTAAAAA
GCAAAGGCATAGACGCATACGCCTTCGACCCTAAGGAAACGCCGTTATCC
GAACTGAAGGAGCGGGGCTTTCAGACGGCATTCAACATCCTTCACGGTAC
TTACGGCGAAGACGGGGCTGTTCAGGGTGCATTGGAACTGTTGGGCATTC
CCTATACCGGCAGCGGTGTCGCCGCCTCCGCCATCGGCATGGACAAATAC
CGCTGCAAACTGATTTGGCAGGCATTGGGATTACCCGTTCCCGAGTTCGC
CGTACTGTACGATGATACCGATTTCGATGCCGTCGAAGAAAAATTGGGTC
TGCCGATGTTTGTGAAGCCGGCGGCCGAAGGCAGCAGCGTCGGCGTGGTA
AAAGTCAAAGAAAAAGGCCGTCTGAAAAGCGTTTACGAAGAATTGAAACA
CCTTCAGGGCGAAATCATTGCCGAACGTTTTATCGGCGGCGGCGAATATT
CCTGCCCCGTCCTGAACGGCAAAGGGCTGCCCGGCATACACATCATCCCC
GCAACCGAGTTTTACGACTACGAAGCCAAGTACAACCGAGACGACACCAT
TTATCAATGTCCTTCGGAAGATTTGACCGAAGCCGAAGAAAGCCTGATGC
GCGAACTGGCGGTTCGCGGCGCACAGGCAATCGGTGCGGAAGGCTGCGTG
CGCGTCGATTTCCTCAAAGATACCGACGGCAAACTCTATCTGTTGGAAAT
CAACACCCTGCCCGGTATGACCGGCCATAGTTTAGTACCGAAATCCGCTG
CCGTTACGGGCGTGGGTTTTGCCGATTTATGTATTGAAATTTTGAAGGCC
GCACATGTGGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy