Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1242.3 IGR1242.4 IGR1244 IGR1247 IGR1246 IGR1243 IGR1245 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522
* Calculated from Protein Sequence

Gene ID: NG1526

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prpB  

Definition:
carboxyphosphonoenolpyruvate phosphonomutase PrpB

Gene Start:
1496812

Gene Stop:
1495937

Gene Length:
876

Molecular Weight*:
31744

pI*:
5.50

Net Charge*:
-5.02

EC:
5.4.2.-  

Functional Class:
Other categories; Adaptations and atypical conditions  

Pathway: pathway table

Secondary Evidence:
Shi L, Kehres DG, Maguire ME.
The PPP-family protein phosphatases PrpA and PrpB of Salmonella enterica serovar Typhimurium possess distinct biochemical
properties.
J Bacteriol. 2001 Dec;183(24):7053-7.
PMID: 11717262

Comment:
Oklahoma ID: NGO.1526c

See 1525 (prpC).

Blast Summary:  PSI-Blast Search
Residues 1-292 in NG1526 have 98% similarity to residues 1-292 in AE002399, N. meningitidis MC58 putative carboxyphosphonoenolpyruvate phosphonomutase.
Residues 2-290 in NG1526 have 69% similarity to residues 1-292 in AE004515, P. aeruginosa carboxyphosphonoenolpyruvate phosphonomutase.



COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 11-238 are 68% similar to a (LYASE ISOCITRATE ISOCITRASE ISOCITRATASE) protein domain (PD001857) which is seen in CPPM_ECOLI.

Residues 241-292 are 50% similar to a (PUTATIVE CARBOXYPHOSPHONOENOLPYRUVATE PHOSPHONOMUTASE) protein domain (PD039194) which is seen in CPPM_ECOLI.



Paralogs:  Local Blast Search


NG1526 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
96  
182

PDB Hit:
pdb|1M1B|1M1B-A CRYSTAL STRUCTURE OF PHOSPHOENOLPYRUVATE MUTASE 96.7 4e-21
pdb|1F61|1F61-A CRYSTAL STRUCTURE OF ISOCITRATE LYASE FROM 72.2 1e-13
pdb|1F8I|1F8I-A CRYSTAL STRUCTURE OF ISOCITRATE 68.3 2e-12
pdb|1IGW|1IGW-A CRYS

Gene Protein Sequence:
MMSQHSAGARFRQAVKESNPLAVAGCVNAYFARLATQSGFKAIYLSGGGV
AACSCGIPDLGITTMEDVLIDARRITDNVDTPLLVDIDVGWGGAFNIART
IRNFERAGVAAVHIEDQVAQKRCGHRRNKAIVSKDEMVDRIKAAVDARVD
ENFVIMARTDALAVEGLDAAIERAQACVEAGADMIFPEAMTDLKMYRQFA
DAVKVPVLANITEFGATPLYTQSELAENGVSLVLYPLSSFRAASKAALNV
YEAIMRDGTQAAVVDSMQTRAELYEHLNYHAFDQKLDKLFQK

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAGTCAACACTCTGCCGGAGCACGTTTCCGCCAAGCTGTGAAAGA
ATCGAATCCGCTTGCCGTCGCCGGTTGCGTCAATGCTTATTTTGCACGAT
TGGCCACCCAAAGCGGTTTCAAAGCCATCTATCTGTCCGGCGGCGGCGTG
GCAGCCTGTTCTTGCGGTATCCCTGATTTGGGCATTACCACAATGGAAGA
TGTGCTGATCGACGCACGACGCATTACGGACAACGTGGATACGCCTCTGC
TGGTGGACATCGATGTGGGTTGGGGCGGTGCATTCAATATTGCCCGTACC
ATTCGCAACTTTGAACGCGCCGGTGTTGCAGCGGTTCACATCGAAGATCA
GGTAGCGCAAAAACGCTGCGGCCACCGTCGGAACAAAGCCATCGTTTCCA
AAGATGAAATGGTCGACCGCATCAAAGCTGCCGTAGATGCGCGCGTTGAT
GAGAACTTCGTGATTATGGCGCGTACCGATGCGCTGGCGGTAGAAGGTTT
GGATGCCGCTATCGAACGCGCTCAGGCTTGTGTCGAAGCCGGTGCGGACA
TGATTTTCCCTGAAGCCATGACCGATTTGAAAATGTACCGTCAATTTGCA
GATGCAGTGAAAGTACCAGTATTGGCCAACATTACCGAGTTTGGTGCTAC
ACCGCTTTATACGCAAAGCGAGTTGGCTGAAAACGGCGTGTCACTGGTGC
TGTATCCGTTGTCATCATTCCGCGCAGCAAGCAAAGCCGCTTTGAATGTT
TACGAAGCGATTATGCGCGATGGCACTCAGGCGGCGGTGGTGGACAGTAT
GCAAACCCGTGCCGAGCTGTACGAGCATCTGAACTATCATGCCTTCGATC
AAAAACTGGATAAATTGTTTCAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy