Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1242.3 IGR1242.4 IGR1244 IGR1247 IGR1246 IGR1243 IGR1242.2 IGR1245 NG1521.2 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522 NG1521.2 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522 NG1521.2 acnA, - NG1523 NG1524 prpB, - NG1526 prpC,gltA, - NG1525 ftsZ, - NG1528 ftsA, - NG1529 NG1527 acnA, - NG1522
* Calculated from Protein Sequence

Gene ID: NG1525

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
prpC  gltA  

Definition:
citrate synthase

Gene Start:
1495849

Gene Stop:
1494704

Gene Length:
1146

Molecular Weight*:
42549

pI*:
7.50

Net Charge*:
3.17

EC:
4.1.3.7  

Functional Class:
Energy metabolism; TCA cycle  

Pathway: pathway table
Citrate cycle (TCA cycle)
Glyoxylate and dicarboxylate metabolism

Secondary Evidence:
Ner,S.S., Bhayana,V., Bell,A.W., Giles,I.G., Duckworth,H.W. and
Bloxham,D.P.
Complete sequence of the gltA gene encoding citrate synthase in
Escherichia coli
Biochemistry 22, 5243-5249 (1983)

Hull,E.P., Spencer,M.E., Wood,D. and Guest,J.R.
Nucleotide sequence of the promoter region of the citrate synthase
gene (gltA) of Escherichia coli
FEBS letters. 156 (2), 366-370 (1983)
Medline: 83210236

Wilde,R.J. and Guest,J.R.
Transcript analysis of the citrate synthase and succinate
dehydrogenase genes of Escherichia coli K12
Journal of general microbiology. 132 (Pt 12), 3239-3251 (1986)
Medline: 88009821

Bhayana,V. and Duckworth,H.W.
Amino acid sequence of Escherichia coli citrate synthase
Biochemistry. 23 (13), 2900-2905 (1984)
Medline: 84280857

Helling,R.B.
icdB mutants of Escherichia coli
Journal of bacteriology. 177 (9), 2592-2593 (1995)
Medline: 95247701



Comment:
For other 'glt' genes see NG1926 (gltX) and NG1890 (gltS).

Oklahoma ID: NGO.1525c

See NG1526 (prpB).

Blast Summary:  PSI-Blast Search
Residues 1-382 in NG1525 have 96% similarity to residues 1-384 in AL162758, N. meningitidis Z2491 citrate synthase.
Residues 1-382 in NG1525 have 71% similarity to residues 1-388 in U51879, S. typhimurium PrpC.
Residues 1-382 in NG1525 have 71% similarity to residues 1-388 inAP002551, E. coli O157:H7 putative citrate synthase.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0372
COG name: Citrate synthase
Functional Class:  C
The phylogenetic pattern of COG0372 is a-T-YqvcEBR-uj------x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB002020 (Citrate synthase) with a combined E-value of 1.8e-72.
    IPB002020A    17-37
    IPB002020B    48-63
    IPB002020C    96-113
    IPB002020D    135-148
    IPB002020E    199-245
    IPB002020F    265-277
    IPB002020G    335-351
    IPB002020H    361-370


ProDom Summary:  Protein Domain Search
Residues 18-137 are 75% similar to a (CITRATE SYNTHASE LYASE TRICARBOXYLIC) protein domain (PD001913) which is seen in CISZ_ECOLI.

Residues 169-382 are 72% similar to a (CITRATE LYASE SYNTHASE TRICARBOXYLIC ACID CYCLE ENZYME) protein domain (PD000990) which is seen in CISZ_ECOLI.

Residues 138-168 are 67% similar to a (METHYLCITRATE SYNTHASE CITRATE LYASE) protein domain (PD191173) which is seen in CISZ_ECOLI.



Paralogs:  Local Blast Search


NG1525 is paralogously related to NG0918 (citrate synthase) (4e-43).


Pfam Summary:  Pfam Search
Residues 18 to 364 (E-value = 7.3e-96) place NG1525 in the Citrate_synt family which is described as Citrate synthase (PF00285)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1A59|1A59 COLD-ACTIVE CITRATE SYNTHASE 249.0 7e-67
pdb|1AJ8|1AJ8-A CITRATE SYNTHASE FROM PYROCOCCUS FURIOSUS 224.0 3e-59
pdb|1O7X|1O7X-A CITRATE SYNTHASE FROM SULFOLOBUS SOLFATARICUS 195.0 1e-50
pdb|1K3P|1K3P-A THRE

Gene Protein Sequence:
MTETTQTPTFKPKKSVALSGVAAGNTALCTVGRTGNDLSHRGYDILNLAQ
KCEFEEVAHLLIHGHLPNKFELAAYKTKLKSMRGLPIRVIKVLESLPAHT
HPMDVMRTGVSMLGCVHPERESHPDSEARDIADKLIASLGSILLYWYQYS
HNGKRIEVESDEETVGGHFLHLLHGKRPSESHIKAMHVSLILYAEHEFNA
STFTARVIAGTGSDMYSCITGAIGALKGPKHGGANEVAYDIQKRYRNADE
ADIRERIGRKEIVIGFGHPVYTISDPRNVVIKEVARGLSREAGDMRLFDI
AERLESVMWEEKKMFPNLDWFSAVSYQKLGVPTAMFTPLFVISRSTGWAA
HVLEQRKDGKIIRPSANYAGPEDLAFVEIEER

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGAAACTACTCAAACCCCGACCTTCAAACCTAAAAAATCCGTTGC
GCTTTCAGGTGTTGCGGCCGGTAATACCGCTTTGTGTACCGTTGGCCGTA
CCGGTAACGATTTGAGCCATCGCGGTTACGACATTCTAAATTTGGCACAA
AAATGCGAGTTTGAAGAAGTCGCACACTTGCTGATTCACGGCCATCTGCC
CAACAAATTCGAGCTGGCCGCTTATAAAACCAAGCTCAAATCCATGCGCG
GCCTGCCTATCCGTGTGATTAAAGTTTTGGAAAGCCTGCCTGCACATACC
CATCCGATGGACGTGATGCGTACCGGCGTGTCCATGCTCGGCTGCGTTCA
TCCCGAACGCGAAAGCCATCCCGACAGCGAAGCGCGCGACATCGCCGACA
AACTGATCGCCAGCCTGGGCAGCATCCTGCTGTACTGGTATCAATATTCG
CACAACGGCAAACGTATTGAAGTTGAAAGCGACGAAGAGACCGTCGGCGG
TCATTTCCTGCACCTGTTGCACGGCAAACGCCCAAGCGAATCACACATCA
AAGCCATGCATGTTTCACTGATTCTGTATGCCGAACACGAGTTCAACGCC
TCCACCTTTACTGCCCGCGTGATTGCCGGTACGGGTTCGGATATGTATTC
CTGCATCACCGGCGCCATCGGCGCGCTTAAAGGTCCGAAACACGGCGGTG
CGAACGAAGTCGCCTACGACATCCAAAAACGCTACCGCAACGCCGACGAA
GCCGACATCCGCGAACGCATCGGCCGCAAAGAAATCGTGATCGGTTTCGG
CCATCCGGTTTACACCATTTCCGACCCGCGCAACGTCGTGATTAAAGAAG
TGGCGCGCGGTTTGAGCCGGGAAGCGGGCGACATGCGCCTCTTCGACATC
GCCGAACGCTTGGAGAGCGTGATGTGGGAAGAGAAAAAAATGTTCCCGAA
TCTGGACTGGTTCTCTGCCGTTTCCTACCAAAAATTGGGCGTACCGACCG
CTATGTTCACACCGCTGTTCGTGATTTCGCGATCCACCGGCTGGGCGGCA
CACGTCCTCGAACAGCGCAAAGACGGCAAAATCATCCGTCCGAGCGCAAA
CTACGCCGGCCCTGAAGATTTGGCGTTTGTGGAGATTGAAGAACGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy