Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1242.3 IGR1242.1 IGR1241 IGR1239 IGR1240 IGR1242 IGR1242.2 NG1517 NG1521.2 NG1521.1 NG1520 acnA, - NG1523 NG1518 nit1, - NG1514 ackA, - NG1521 NG1516 acnA, - NG1522 NG1519 tyrC, - NG1515 NG1517 NG1521.2 NG1521.1 NG1520 acnA, - NG1523 NG1518 nit1, - NG1514 ackA, - NG1521 NG1516 acnA, - NG1522 NG1519 tyrC, - NG1515 NG1521.1 NG1520 acnA, - NG1523 NG1518 nit1, - NG1514 ackA, - NG1521 NG1516 acnA, - NG1522 NG1517 NG1521.2 NG1519 tyrC, - NG1515
* Calculated from Protein Sequence

Gene ID: NG1521

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ackA  

Definition:
acetate kinase (AckA)

Gene Start:
1489055

Gene Stop:
1487859

Gene Length:
1197

Molecular Weight*:
42959

pI*:
6.60

Net Charge*:
-2.52

EC:
2.7.2.1  

Functional Class:
Other categories; Other  

Pathway: pathway table
Propanoate metabolism
Pyruvate metabolism

Secondary Evidence:
Matsuyama,A., Yamamoto,H. and Nakano,E.
Cloning, expression, and nucleotide sequence of the Escherichia
coli K-12 ackA gene
J. Bacteriol. 171 (1), 577-580 (1989)
Medline: 89123075


Kakuda,H., Hosono,K., Shiroishi,K. and Ichihara,S.
Identification and characterization of the ackA (acetate kinase
A)-pta (phosphotransacetylase) operon and complementation analysis of acetate utilization by an ackA-pta deletion mutant of
Escherichia coli
J. Biochem. 116 (4), 916-922 (1994)
Medline: 95189796


Comment:
Oklahoma ID: NGO.1521c

Blast Summary:  PSI-Blast Search
Residues 1-399 in NG1521 have 94% similarity to residues 1-399 in AE002400, N. meningitidis MC58 acetate kinase.
Residues 7-397 in NG1521 have 51% similarity to residues 4-392 in AE002089, D. radiodurans acetate kinase.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0282
COG name: Acetate kinase
Functional Class:  C
The phylogenetic pattern of COG0282 is ------VcEBrhujgpol--x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB000890 (Acetate and butyrate kinase) with a combined E-value of 2.1e-98.
    IPB000890A    6-17
    IPB000890B    85-95
    IPB000890C    117-129
    IPB000890D    142-163
    IPB000890E    172-185
    IPB000890F    205-243
    IPB000890G    266-277
    IPB000890H    322-333
    IPB000890I    380-389


ProDom Summary:  Protein Domain Search
Residues 4-385 are 44% similar to a (KINASE TRANSFERASE ACETATE ACETOKINASE) protein domain (PD003226) which is seen in ACKA_HAEIN.



Paralogs:  Local Blast Search


NG1521 is paralogously related to NG0977 (acetate kinase) (1e-139).


Pfam Summary:  Pfam Search
Residues 5 to 390 (E-value = 1.4e-167) place NG1521 in the Acetate_kinase family which is described as Acetokinase family (PF00871)

Structural Feature(s):
Feature Type  Start  Stop
cleavable N-terminal sequence  
1  
18
transmembrane  
311  
327

PDB Hit:
pdb|1G99|1G99-A AN ANCIENT ENZYME: ACETATE KINASE FROM 326.0 4e-90

Gene Protein Sequence:
MSDQLILVLNCVSSSLKGAVIDRKSGSVVLSCLGERLTTPEAVITFNKDG
NKRQVPLSGRNCHAGAVGMLLNELEKHGLHDRIKAIGRRIAHGGEKYHES
VLIDQDVLDELKACIPFAPLHNPANISGILAAQEHFPGLPNVGVMDTSFH
QTMPERAYTYAVPRELRKKYAFRRYGFHGTGMRYVAPEAARILGKPLEDI
RMIIAHLGNGASITAVKNGKSVDTGMGFTPIEGLVMGTRCGDTDPGVYSY
PTFHAGMDVAQVDEMLNEKSGFPGISELPNDCRTLEIAADEGREGARLAL
EVMTCRLAKYIASMAVACGSVDALVFTGGIGENSRNIRAKTVSYLDFLGL
HIDTKANMEKRYGNSGIISPTDSSPAVLVVPTNEELMIACDTAELAGIL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGACCAACTCATTCTTGTCCTGAACTGCGTCAGTTCATCGCTCAA
AGGCGCCGTTATCGACCGCAAAAGCGGCAGCGTCGTCCTAAGCTGCCTCG
GGGAACGCCTGACTACGCCCGAAGCCGTCATTACCTTCAACAAAGACGGC
AACAAACGCCAAGTTCCCCTGAGCGGCCGCAACTGCCACGCCGGCGCGGT
GGGTATGCTGTTGAACGAACTGGAAAAACACGGACTGCACGACCGCATCA
AAGCCATCGGCCGCCGCATCGCCCACGGCGGCGAAAAATATCACGAGTCC
GTCCTCATCGACCAAGACGTCCTTGACGAACTGAAAGCCTGCATCCCGTT
CGCCCCGCTGCACAACCCCGCCAACATCAGCGGCATCCTCGCCGCGCAGG
AACACTTTCCCGGCCTGCCCAACGTCGGCGTGATGGACACCTCGTTCCAC
CAAACCATGCCGGAGCGGGCCTACACTTATGCCGTGCCGCGCGAATTGCG
CAAAAAATACGCCTTCCGCCGCTACGGTTTCCACGGTACCGGTATGCGTT
ACGTCGCCCCTGAAGCCGCACGCATCTTGGGCAAACCTCTGGAAGACATC
CGCATGATTATTGCCCACTTAGGCAACGGCGCATCTATTACCGCCGTCAA
AAACGGCAAATCCGTCGATACCGGTATGGGTTTCACGCCGATCGAAGGTT
TGGTAATGGGTACACGTTGCGGCGACACCGATCCGGGCGTATACAGCTAT
CCGACTTTCCACGCAGGGATGGATGTTGCCCAAGTTGATGAAATGCTGAA
CGAAAAATCAGGTTTCCCCGGTATTTCCGAACTTCCCAACGACTGCCGCA
CCCTCGAAATCGCCGCCGACGAAGGCCGCGAAGGCGCGCGCCTCGCCCTC
GAAGTCATGACCTGCCGCCTCGCCAAATACATCGCTTCGATGGCTGTGGC
CTGCGGCAGTGTTGACGCACTCGTGTTCACCGGCGGTATCGGCGAAAACT
CGCGTAATATCCGTGCCAAAACCGTTTCCTATCTTGATTTCTTGGGTCTG
CACATCGACACCAAAGCCAATATGGAAAAACGCTACGGCAATTCGGGCAT
TATCAGCCCGACCGATTCTTCTCCGGCTGTTTTGGTCGTCCCGACCAATG
AAGAACTGATGATTGCCTGCGACACTGCCGAACTTGCCGGCATCTTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy