Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1241 IGR1239 IGR1240 IGR1236 IGR1242 IGR1237.1 IGR1237 IGR1238 NG1517 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515 NG1517 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515 Type: inverse, Name:  - 180 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: inverse, Name:  - 168 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 NG1517 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515
* Calculated from Protein Sequence

Gene ID: NG1515

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
tyrC  

Definition:
prephenate dehydrogenase TyrC

Gene Start:
1483849

Gene Stop:
1484718

Gene Length:
870

Molecular Weight*:
31571

pI*:
6.30

Net Charge*:
-5.01

EC:
1.3.1.12  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Fischer,R.S., Zhao,G. and Jensen,R.A.
Cloning, sequencing, and expression of the P-protein gene (pheA) of Pseudomonas stutzeri in Escherichia coli: implications for
evolutionary relationships in phenylalanine biosynthesis
J. Gen. Microbiol. 137 (Pt 6), 1293-1301 (1991)
Medline: 92013931

Hudson,G.S. and Davidson,B.E.
Nucleotide sequence and transcription of the phenylalanine and
tyrosine operons of Escherichia coli K12
J. Mol. Biol. 180 (4), 1023-1051 (1984)
Medline: 85134883


Comment:
For other 'tyr' genes see NG0066 (tyrS) and NG1329 (tyrB).
Oklahoma ID: NGO.1515

Blast Summary:  PSI-Blast Search
Residues 1-290 in NG1515 have 95% similarity to residues 1-290 in AF058689, N. meningitidis putative prephenate dehydrogenase TyrC.

Numerous hits in gapped BLAST to prephenate dehydrogenase sequences,e.g.residues 2-286 in NG1515 have 39% similarity to residues 12-295 in AE004740, P. aeruginosa prephenate dehydrogenase.Residues 2-286 in NG1515 have 38% similarity to residues 12-294 in AF182427, B. bronchiseptica prephenate dehydrogenase; chorismate mutase.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0287
COG name: Prephenate dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0287 is amt-yqvcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 15-284 are 37% similar to a (PREPHENATE DEHYDROGENASE OXIDOREDUCTASE) protein domain (PD004672) which is seen in TYRA_BACSU.



Paralogs:  Local Blast Search


NG1515 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 283 (E-value = 1e-69) place NG1515 in the PDH family which is described as Prephenate dehydrogenase (PF02153)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
117
uncleavable N-terminal sequence N-terminal sequence  
1  
23
transmembrane  
7  
23
transmembrane  
69  
85

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MPILNHIALIGVGLIGGSFVLDLKRQGLVRTVTGIDTDRDNLERALERGV
IDRASVVIDADSIGGADLVLIATPVATVPAVLTALRPVLPEHTWISDVGS
TKSSVIEAFRRCLPGRLHRCIAAHPIAGSDRNGAQAAQFGLFRHRKLIIT
PHGGEDSDGIALVENLWRAVGADIFTMDAQHHDAVFAAVSHMPHLTAFAY
VHQILDHPDGQEYLKFAATGFRDFTRIASGHPAVWADICLANKDSLLQLV
QGLGKQLDVLADILTADDREALYRYFEEAKTTRDRWLDGN

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCATTTTGAACCATATTGCCCTCATCGGTGTAGGGCTGATCGGCGG
TTCGTTCGTTCTCGACCTCAAAAGGCAGGGACTCGTCCGCACCGTTACCG
GTATCGACACCGACCGCGACAACCTCGAACGTGCATTGGAACGCGGCGTG
ATTGACCGTGCGTCCGTCGTCATCGACGCGGACAGCATCGGCGGTGCGGA
CTTGGTACTGATTGCCACGCCCGTCGCCACCGTTCCCGCCGTTTTAACCG
CGCTGCGCCCCGTTTTGCCGGAACACACTTGGATTTCCGATGTCGGCAGC
ACCAAATCTTCGGTCATCGAAGCCTTCCGCCGCTGCCTGCCCGGCCGCCT
GCACCGCTGCATCGCCGCACACCCGATTGCCGGTTCGGACAGAAACGGTG
CGCAAGCCGCGCAGTTCGGGCTGTTCCGCCACAGAAAACTCATCATCACG
CCCCACGGCGGCGAAGATTCAGACGGCATCGCATTGGTAGAAAACCTGTG
GCGCGCGGTCGGTGCGGACATTTTCACGATGGACGCGCAACACCACGACG
CGGTTTTCGCCGCCGTCTCCCATATGCCCCACCTGACCGCCTTCGCCTAT
GTCCACCAGATTCTCGACCACCCCGACGGGCAGGAATATCTGAAATTCGC
CGCCACGGGCTTTCGGGACTTCACCCGCATCGCCTCCGGCCATCCCGCCG
TGTGGGCGGACATCTGCCTTGCCAACAAAGACAGCCTGCTGCAACTGGTT
CAAGGCTTGGGCAAACAGTTGGACGTTTTGGCAGACATCCTGACCGCCGA
CGACCGCGAAGCCCTGTACCGCTATTTTGAAGAAGCCAAAACCACGCGCG
ACCGCTGGCTGGACGGCAAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy