Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1241 IGR1239 IGR1240 IGR1236 IGR1237.1 IGR1237 IGR1238 NG1517 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 bcr, - NG1511 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515 NG1517 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 bcr, - NG1511 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515 Type: inverse, Name:  - 180 Type: tandem, Name:  - 70 Type: tandem, Name:  - 71 Type: inverse, Name:  - 168 NG1520 NG1518 NG1512 nit1, - NG1514 ackA, - NG1521 NG1516 bcr, - NG1511 NG1517 pilS, - NG1512.1 NG1519 opa,P.II, - NG1513 tyrC, - NG1515
* Calculated from Protein Sequence

Gene ID: NG1514

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nit1  

Definition:
nitrilase 1 homolog

Gene Start:
1483866

Gene Stop:
1482955

Gene Length:
912

Molecular Weight*:
33187

pI*:
7.50

Net Charge*:
1.94

EC:
3.5.5.1  4.2.1.84  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Benzoate degradation via CoA ligation
Cyanoamino acid metabolism
Nitrogen metabolism
Styrene degradation
Tryptophan metabolism

Comment:
Oklahoma ID: NGO.1514c

Blast Summary:  PSI-Blast Search
Residues 35-304 in NG1514 have 97% similarity to residues 1-270 in AE002400, N. meningitidis MC58 nitrilase.
Residues 20-302 in NG1514 have 37% similarity to residues 6-283 in AF069986, C. elegans nitrilase and fragile histidine triad fusion protein NitFhit.
Residues 40-302 in NG1514 have 38% similarity to residues 9-277 in AF284575, X. laevis Nit protein 1.


COGS Summary:  COGS Search
BeTs to 11 clades of COG0388
COG name: Predicted amidohydrolase
Functional Class:  R
The phylogenetic pattern of COG0388 is A-tkYQVCEBR-UJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001110 (Uncharacterized protein family UPF0012) with a combined E-value of 7.2e-34.
    IPB001110B    148-156
    IPB001110C    184-205
    IPB001110D    222-238
    IPB001110E    255-264
***** IPB000132 (Nitrilase / cyanide hydratase) with a combined E-value of 3e-08.
    IPB000132A    50-84
    IPB000132D    255-264
    IPB000132E    274-303


ProDom Summary:  Protein Domain Search
Residues 41-299 are 41% similar to a (PROTEIN HYDROLASE NITRILASE ALIPHATIC AMIDASE PUTATIVE) protein domain (PD000957) which is seen in O83040_PLEBO.



Paralogs:  Local Blast Search


NG1514 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 39 to 213 (E-value = 1.2e-19) place NG1514 in the CN_hydrolase family which is described as Carbon-nitrogen hydrolase (PF00795)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EMS|1EMS-A CRYSTAL STRUCTURE OF THE C. ELEGANS NITFHIT 168.0 1e-42
pdb|1F89|1F89-A CRYSTAL STRUCTURE OF YEAST HYPOTHETICAL PROTEIN,133.0 5e-32
pdb|1ERZ|1ERZ-A CRYSTAL STRUCTURE OF N-CARBAMYL-D-AMINO ACID 50.4 4e-07
pdb|1FO6|1FO6-A CRYS

Gene Protein Sequence:
MVQNGHLCKRFSQSAAMVAYRRNMPQGRQEKGEEMDKIRVAAVQMVSGVS
PETNVAAMKRLVARAAEQGADWVLLPEYWVLMGANDTGKLALAEPLGGGR
FQTALSETAKECGVVLFGGTVPLQSPEAGKVMNTLLVYGCDGVRTGLYHK
MHLFGFSGLGERYAEADTIRAGREVPHLSAEGMPVAAGICYDVRFPEFFR
RQLPFDVLMLPAAFTHTTGKAHWELLLRARAVENQCYVVAAAQGGLHENG
RRTFGHSMIVDPWGDVLDVLPEGEGIVTADIDANRLNSVRNRLPALKHRV
LDAV

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTCAAAATGGGCATTTGTGTAAACGGTTTTCGCAAAGTGCCGCCAT
GGTAGCCTATCGGCGGAATATGCCGCAAGGTCGGCAGGAAAAAGGAGAAG
AAATGGACAAAATCAGAGTTGCCGCCGTGCAGATGGTGTCGGGCGTGTCG
CCGGAAACCAACGTCGCCGCCATGAAACGCCTGGTCGCACGGGCGGCGGA
GCAGGGTGCGGATTGGGTGCTGCTGCCCGAATATTGGGTGCTGATGGGCG
CAAACGATACCGGCAAACTCGCACTTGCCGAGCCTTTGGGCGGCGGACGC
TTTCAGACGGCATTGAGCGAAACGGCGAAAGAATGCGGCGTGGTGCTGTT
CGGCGGAACCGTGCCGCTGCAAAGCCCCGAAGCGGGCAAGGTCATGAATA
CTTTATTGGTGTACGGGTGCGACGGCGTAAGGACGGGGCTGTACCACAAA
ATGCACCTCTTCGGTTTTTCCGGTTTGGGCGAACGCTATGCCGAAGCCGA
TACCATCCGCGCAGGGCGGGAAGTGCCGCACTTGTCGGCAGAAGGCATGC
CGGTGGCGGCAGGTATTTGTTACGATGTCCGCTTTCCCGAATTTTTCCGC
CGCCAACTGCCGTTTGACGTATTGATGCTGCCGGCGGCATTTACCCATAC
GACGGGCAAGGCGCACTGGGAGCTGCTGCTGCGCGCGCGCGCCGTCGAAA
ACCAATGTTACGTCGTGGCGGCGGCACAGGGCGGTTTGCACGAAAACGGA
CGGCGCACGTTCGGACACAGTATGATTGTCGATCCGTGGGGCGACGTGTT
GGACGTATTACCCGAAGGCGAAGGCATCGTTACGGCAGACATCGATGCCA
ACCGCCTGAACAGCGTCCGCAACCGCCTGCCCGCCTTGAAACACCGGGTT
TTGGATGCCGTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy