Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1234 IGR1229 IGR1235 IGR1231 IGR1230 IGR1233 IGR1232 IGR1236 dpj, - NG1507 recO, - NG1509 pdxJ, - NG1508 mutT, - NG1506 NG1512 NG1504 bcr, - NG1511 NG1503 amiC, - NG1502 dpj, - NG1507 recO, - NG1509 pdxJ, - NG1508 mutT, - NG1506 NG1512 NG1504 bcr, - NG1511 NG1503 amiC, - NG1502 dpj, - NG1507 recO, - NG1509 pdxJ, - NG1508 mutT, - NG1506 NG1512 NG1504 bcr, - NG1511 NG1505 pheA, - NG1510 NG1505 pheA, - NG1510 NG1503 amiC, - NG1502 NG1501 NG1501
* Calculated from Protein Sequence

Gene ID: NG1507

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dpj  

Definition:
holo-(acyl-carrier protein) synthase Dpj

Gene Start:
1475440

Gene Stop:
1475066

Gene Length:
375

Molecular Weight*:
13492

pI*:
8.40

Net Charge*:
1.19

EC:
2.7.8.7  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Pantothenate  

Pathway: pathway table
Pantothenate and CoA biosynthesis

Secondary Evidence:
Lambalot,R.H. and Walsh,C.T.
Cloning, overproduction, and characterization of the Escherichia
coli holo-acyl carrier protein synthase
J. Biol. Chem. 270 (42), 24658-24661 (1995)
M:96027548


Comment:
Oklahoma ID: NGO.1507c

Blast Summary:  PSI-Blast Search
Residues 1-125 in NG1507 have 93% similarity to residues 1-125 in AF058689, N. meningitidis putative holo-[acyl-carrier protein] synthase Dpj.
Residues 1-125 in NG1507 have 40% similarity to residues 1-125 in
AE004316, V. cholerae holo-(acyl-carrier-protein) synthase.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0736
COG name: Acyl-carrier protein synthase
Functional Class:  I
The phylogenetic pattern of COG0736 is ----Yqv-ebr-uj-polinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002582 (Holo-acyl carrier protein synthase) with a combined E-value of 1.3e-20.
    IPB002582A    4-15
    IPB002582B    49-64
    IPB002582C    75-86


ProDom Summary:  Protein Domain Search
Residues 2-124 are 30% similar to a (SYNTHASE PROTEIN TRANSFERASE) protein domain (PD004282) which is seen in ACPS_ECOLI.



Paralogs:  Local Blast Search


NG1507 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 5 to 72 (E-value = 1.2e-17) place NG1507 in the ACPS family which is described as 4'-phosphopantetheinyl transferase superfamily (PF01648)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1F7T|1F7T-A HOLO-(ACYL CARRIER PROTEIN) SYNTHASE AT 1.8A 44.1 1e-05
pdb|1F7L|1F7L-A HOLO-(ACYL CARRIER PROTEIN) SYNTHASE IN 44.1 1e-05
pdb|1F80|1F80-A HOLO-(ACYL CARRIER PROTEIN) SYNTHASE IN 42.6 3e-05
pdb|1F7T|1F7T-A HOLO

Gene Protein Sequence:
MIYGIGTDIVSLKRIIRLNKKFGQAFAGRILTPEELLEFPQAGKPVNYLA
KRFAAKEAFAKAVGTGIRGAVSFCNIGIGHDALGKPEFFYGPALSEWLEE
QGISRVSLSMADEGDTVLAFAVAEK

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTACGGCATCGGTACAGACATCGTTTCCCTCAAGCGCATCATCCG
CTTAAACAAAAAATTCGGACAGGCGTTTGCAGGGCGCATACTCACTCCCG
AAGAGCTGCTTGAATTTCCGCAGGCGGGCAAACCCGTCAACTACCTTGCC
AAACGCTTTGCCGCCAAAGAAGCCTTCGCCAAAGCCGTCGGCACGGGCAT
ACGAGGCGCGGTTTCCTTCTGCAACATCGGCATCGGGCACGACGCATTGG
GCAAGCCCGAATTTTTCTACGGCCCCGCCCTGTCCGAATGGCTGGAAGAA
CAAGGCATCAGCCGCGTCAGCCTGAGTATGGCGGACGAAGGCGATACCGT
GTTGGCGTTTGCCGTTGCCGAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy