Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1229 IGR1231 IGR1230 IGR1224 IGR1225 IGR1228 IGR1226 IGR1226.1 IGR1227 NG1497 NG1498 mutT, - NG1506 murI, - NG1500 NG1504 tbpB,lbpB,tbp-2, - NG1496 NG1498.1 NG1503 NG1499 amiC, - NG1502 NG1497 NG1498 mutT, - NG1506 murI, - NG1500 NG1504 tbpB,lbpB,tbp-2, - NG1496 NG1498.1 NG1503 NG1499 amiC, - NG1502 Type: tandem, Name:  - 69 Type: tandem, Name:  - 68 NG1498 murI, - NG1500 NG1504 tbpB,lbpB,tbp-2, - NG1496 NG1505 mutT, - NG1506 NG1497 NG1505 NG1498.1 NG1503 NG1499 amiC, - NG1502 NG1501 NG1501
* Calculated from Protein Sequence

Gene ID: NG1500

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murI  

Definition:
glutamate racemase (MurI)

Gene Start:
1469723

Gene Stop:
1468914

Gene Length:
810

Molecular Weight*:
29501

pI*:
7.00

Net Charge*:
0.00

EC:
5.1.1.3  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Glutamine and D-glutamate metabolism
Glutamate metabolism

Secondary Evidence:
Doublet,P., van Heijenoort,J. and Mengin-Lecreulx,D.
Identification of the Escherichia coli murI gene, which is required for the biosynthesis of D-glutamic acid, a specific component of bacterial peptidoglycan
J. Bacteriol. 174 (18), 5772-5779 (1992)
M:92394878

Doublet,P., van Heijenoort,J., Bohin,J.P. and Mengin-Lecreulx,D.
The murI gene of Escherichia coli is an essential gene that encodes a glutamate racemase activity
J. Bacteriol. 175 (10), 2970-2979 (1993)
M:93259941


Comment:
Oklahoma ID: NGO.1500c

For other 'mur' genes, see NG0394 (murB), NG1532 (murC), NG1533 (murG), NG1535 (murD), NG1539 (murF), NG1541 (murE), NG1918 (murA).

Blast Summary:  PSI-Blast Search
Residues 1-270 in NG1500 have 98% similarity to residues 1-270 in AF194079, N. meningitidis MurI.
Residues 7-269 in NG1500 have 40% similarity to residues 3-266 in Z99118, B. subtilis glutamate racemase.


COGS Summary:  COGS Search
BeTs to 8 clades of COG0796
COG name: Glutamate racemase
Functional Class:  M
The phylogenetic pattern of COG0796 is -----q-ceBrhuj--ol---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001920 (Aspartate and glutamate racemases) with a combined E-value of 7.3e-45.
    IPB001920A    10-41
    IPB001920B    70-100
    IPB001920C    117-128
    IPB001920D    183-199


ProDom Summary:  Protein Domain Search
Residues 148-257 are 36% similar to a (GLUTAMATE RACEMASE PEPTIDOGLYCAN) protein domain (PD004566) which is seen in MURI_BACSH.

Residues 12-199 are 30% similar to a (GLUTAMATE RACEMASE MURI) protein domain (PD111847) which is seen in O51127_BORBU.

Residues 47-133 are 47% similar to a (RACEMASE GLUTAMATE ISOMERASE) protein domain (PD002869) which is seen in MURI_LACBR.

Residues 10-46 are 70% similar to a (GLUTAMATE RACEMASE PEPTIDOGLYCAN) protein domain (PD004303) which is seen in MURI_SYNY3.



Paralogs:  Local Blast Search


NG1500 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 9 to 224 (E-value = 2.4e-95) place NG1500 in the Asp_Glu_race family which is described as Asp/Glu/Hydantoin racemase (PF01177)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1B73|1B73-A GLUTAMATE RACEMASE FROM AQUIFEX PYROPHILUS 174.0 1e-44

Gene Protein Sequence:
MENIGRQRPIGVFDSGIGGLTNVRALMERLPMENIIYFGDTARVPYGTKS
KATIENFSMQIVDFLLGHDVKAMVIACNTIAAVAGRKIRQKTGNMPVLDV
ISAGAKAALATTRNNKIGIIATNTTVNSNAYARAIHRDNPDTLVRTQAAP
LLVPLVEEGWLEHEVTRLTVCEYLKPLLADGIDTLVLGCTHFPLLKPLIG
REAHNVALVDSAITTAEETARVLAQEGLLDTGNNNPDYRFYVSDIPLKFR
TIGERFLGRTMEQIEMVSLG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAATATCGGCAGGCAGCGGCCCATCGGCGTTTTTGACTCGGGAAT
CGGCGGTTTGACCAATGTGCGCGCGCTGATGGAACGGCTGCCGATGGAGA
ACATCATTTATTTCGGCGACACGGCGCGCGTGCCTTACGGGACGAAATCT
AAGGCGACCATCGAAAATTTCTCGATGCAGATTGTCGATTTTTTATTGGG
ACACGATGTCAAGGCGATGGTTATCGCGTGCAACACGATTGCGGCGGTTG
CGGGGCGGAAAATCCGTCAAAAGACGGGCAATATGCCCGTTTTGGACGTG
ATTTCCGCCGGCGCCAAAGCCGCGCTGGCAACGACGCGCAACAATAAAAT
CGGCATCATCGCCACCAATACGACAGTCAACAGCAATGCTTATGCGCGCG
CCATCCACAGGGACAACCCCGACACGCTCGTCCGCACGCAGGCCGCGCCG
CTGCTCGTCCCTTTGGTGGAGGAAGGTTGGTTGGAACACGAAGTTACCCG
CCTGACCGTATGCGAATACCTCAAACCATTGCTTGCAGACGGCATCGATA
CGCTGGTGTTGGGCTGCACGCACTTTCCCTTGCTCAAGCCCTTAATCGGC
AGGGAGGCGCACAATGTCGCGCTGGTCGATTCCGCGATTACGACGGCCGA
AGAAACCGCACGCGTCCTTGCACAGGAAGGATTGCTCGATACCGGCAACA
ACAATCCCGACTACCGTTTTTACGTCAGCGATATTCCTTTGAAATTCAGA
ACCATCGGCGAGCGTTTTCTGGGCAGGACGATGGAGCAGATTGAAATGGT
GTCTTTGGGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy