Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1217 IGR1218 IGR1219 IGR1216 IGR1220 IGR1215 IGR1221 IGR1222 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 tbp-1,tbpA,lbpA, - NG1495 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 tbp-1,tbpA,lbpA, - NG1495 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 tbp-1,tbpA,lbpA, - NG1495 potF, - NG1494
* Calculated from Protein Sequence

Gene ID: NG1492

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pldA  

Definition:
phospholipase A1

Gene Start:
1456750

Gene Stop:
1455605

Gene Length:
1146

Molecular Weight*:
42809

pI*:
9.60

Net Charge*:
5.88

EC:
3.1.1.32  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Phospholipid degradation

Secondary Evidence:
Brok,R.G., Boots,A.P., Dekker,N., Verheij,H.M. and Tommassen,J.
Sequence comparison of outer membrane phospholipases A:
implications for structure and for the catalytic mechanism.
Res. Microbiol. 149 (10), 703-710 (1998)
M:99120145

Tannaes T, Dekker N, Bukholm G, Bijlsma JJ, Appelmelk BJ.
Phase variation in the Helicobacter pylori phospholipase A gene and its role in acid adaptation.
Infect Immun. 2001 Dec;69(12):7334-40.
PMID: 11705905

Langen GR, Harper JR, Silhavy TJ, Howard SP.
Absence of the outer membrane phospholipase A suppresses the temperature-sensitive phenotype of Escherichia coli degP mutants and induces the Cpx and sigma(E) extracytoplasmic stress responses.
J Bacteriol. 2001 Sep;183(18):5230-8.
PMID: 11514504

Dorrell N, Martino MC, Stabler RA, Ward SJ, Zhang ZW, McColm AA, Farthing MJ, Wren BW.
Characterization of Helicobacter pylori PldA, a phospholipase with a role in colonization of the gastric mucosa.
Gastroenterology. 1999 Nov;117(5):1098-104.
PMID: 10535872




Comment:
Oklahoma ID: NGO.1492c

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to phospholipase A1 sequences. Residues 96-378 are 34% similar to residues 13-284 of PA1_KLEPN (X76901).

Residues 1-382 are virtually identical to NMB0464 in N.meningitidis (gb|AAF40901).

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** PR01486 (Bacterial phospholipase A1 protein signature) with a combined E-value of 7.4e-38.
    PR01486A    165-182
    PR01486B    187-203
    PR01486C    211-230
    PR01486D    242-256
    PR01486E    257-275
    PR01486F    293-311
    PR01486G    327-344
    PR01486H    349-369


ProDom Summary:  Protein Domain Search
Residues 133-378 are 37% similar to a (PHOSPHOLIPASE A1 A PRECURSOR DR-PHOSPHOLIPASE OUTER) protein domain (PD009894) which is seen in Q9Z4N8_ENTAG.



Paralogs:  Local Blast Search


NG1492 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 105 to 377 (E-value = 1.4e-39) place NG1492 in the PLA1 family which is described as Phospholipase A1 (PF02253)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1FW2|1FW2-A OUTER MEMBRANE PHOSPHOLIPASE A FROM ESCHERICHIA 145.0 1e-35
pdb|1QD6|1QD6-C OUTER MEMBRANE PHOSPHOLIPASE A FROM ESCHERICHIA 144.0 2e-35
pdb|1FW3|1FW3-A OUTER MEMBRANE PHOSPHOLIPASE A FROM ESCHERICHIA 144.0 3e-35
pdb|1ILD|1ILD-A OUTE

Gene Protein Sequence:
MPTMGAEMNTRNMRYILLTGLLPTASAFGETALQCAALTDNVTRLACYDR
IFAAQLPSSAGQEGQESKAVLNLTETVRSSLDKGEAVIVVEKGGDALPAD
SAGETADIYTPLSLMYDLDKNDLRGLLGVREHNPMYLMPFWYNNSPNYAP
SSPTRGTTVQEKFGQQKRAETKLQVSFKSKIAENLFKTRADLWFGYTQRS
DWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLRMLGAGFVHQS
NGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIAD
YMGYGDVKLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVV
RGFHGYGESLIDYNHKQNGIGIGLMFNDWDGI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGACAATGGGGGCGGAGATGAATACACGAAATATGCGCTATATTCT
TTTGACAGGACTGTTGCCGACGGCATCCGCTTTTGGAGAGACCGCGCTGC
AATGCGCCGCTTTGACGGACAATGTTACGCGTTTGGCGTGTTACGACAGG
ATTTTTGCGGCACAGCTTCCGTCTTCGGCAGGGCAGGAAGGGCAGGAGTC
GAAAGCCGTACTCAATCTGACGGAAACCGTCCGCAGCAGCTTGGATAAGG
GCGAGGCGGTCATTGTTGTTGAAAAAGGCGGGGATGCGCTTCCTGCCGAC
AGTGCGGGCGAAACCGCCGATATCTATACGCCTTTGAGCCTGATGTACGA
CTTGGACAAAAACGATTTGCGCGGGCTGTTGGGCGTACGCGAACACAATC
CGATGTACCTTATGCCGTTTTGGTATAACAATTCGCCCAACTATGCCCCG
AGTTCGCCGACGCGCGGTACGACTGTACAGGAAAAATTCGGACAGCAGAA
ACGTGCGGAAACCAAATTGCAGGTTTCGTTCAAAAGCAAAATTGCCGAAA
ATTTGTTTAAAACCCGCGCGGATCTGTGGTTCGGCTACACCCAAAGATCC
GATTGGCAGATTTACAACCAAGGCAGGAAATCCGCGCCGTTCCGCAATAC
GGATTACAAACCTGAAATTTTCCTGACCCAGCCTGTGAAGGCGGATTTGC
CGTTCGGCGGCAGGCTGCGTATGCTCGGTGCGGGTTTTGTCCACCAGTCC
AACGGACAGAGCCGTCCCGAATCGCGTTCGTGGAACAGGATTTATGCCAT
GGCAGGCATGGAATGGGGCAAATTGACGGTGATTCCGCGCGTGTGGGTGC
GTGCGTTCGATCAGAGCGGCGATAAAAACGACAATCCCGATATTGCCGAC
TATATGGGGTATGGCGACGTGAAGCTGCAGTACCGCCTGAACGACAGGCA
GAATGTGTATTCCGTATTGCGCTACAACCCCAAAACGGGCTACGGCGCGA
TTGAAGCCGCCTACACGTTTCCGATTAAGGGCAAACTCAAAGGCGTGGTA
CGCGGATTCCACGGTTACGGCGAGAGCCTGATCGACTACAACCACAAGCA
GAACGGTATCGGTATCGGGTTGATGTTCAACGACTGGGACGGCATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy