Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1217 IGR1218 IGR1214 IGR1219 IGR1216 IGR1220 IGR1215 IGR1221 IGR1222 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 aspS, - NG1489 speA, - NG1487 potF, - NG1494
* Calculated from Protein Sequence

Gene ID: NG1490

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase fragment

Gene Start:
1454701

Gene Stop:
1454450

Gene Length:
252

Molecular Weight*:
9591

pI*:
8.70

Net Charge*:
2.61

EC:
6.1.1.12  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Alanine and aspartate metabolism
Aminoacyl-tRNA biosynthesis

Comment:
Oklahoma ID: NGO.1490c

For other 'asp' genes', see NG0556 (aspA), NG1452 (aspC) and NG1489 (aspS).

Blast Summary:  PSI-Blast Search
Weak matches in gapped BLAST to aspRS sequences. Residues 1-80 are 61% similar to SYD_PSEAE (gb|AAG04352).

Residues 1-80 are 93% similar to NMB0466 in N.meningitidis (gb|AAF40903).

COGS Summary:  COGS Search
BeTs to 10 clades of COG0173
COG name: Aspartyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0173 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 28-80 are 64% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002022) which is seen in SYD_AQUAE.



Paralogs:  Local Blast Search


NG1490 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 83 (E-value = 2.6e-15) place NG1490 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EQR|1EQR-A CRYSTAL STRUCTURE OF FREE ASPARTYL-TRNA 89.3 1e-19
pdb|1C0A|1C0A-A CRYSTAL STRUCTURE OF THE E. COLI ASPARTYL-TRNA 89.3 1e-19
pdb|1EFW|1EFW-A CRYSTAL STRUCTURE OF ASPARTYL-TRNA SYNTHETASE 83.9 6e-18
pdb|1C0A|1C0A-A CRYS

Gene Protein Sequence:
MRTNYCGLISEQYLCQTVTVKGWVHRRRDHGGVIFIDLRDREGIVQVVID
PDTPEAFAAADSARNEYVLGIAGRVRNRPKHDQR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTACCAACTATTGCGGCCTGATCAGCGAGCAATACTTATGCCAAAC
CGTTACCGTCAAAGGCTGGGTACACCGCCGGCGCGACCACGGCGGTGTGA
TTTTTATCGACCTGCGCGACCGCGAAGGCATCGTCCAAGTCGTGATCGAT
CCCGACACGCCCGAAGCGTTTGCCGCTGCCGATTCCGCCCGTAACGAATA
CGTTTTGGGCATTGCCGGCCGCGTACGCAACCGTCCGAAGCACGACCAAC
GA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy