Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1217 IGR1218 IGR1214 IGR1219 IGR1216 IGR1220 IGR1215 IGR1213 IGR1221 IGR1222 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 potF, - NG1494 aspS, - NG1490 rpsT, - NG1493 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 potF, - NG1494
* Calculated from Protein Sequence

Gene ID: NG1489

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspS  

Definition:
aspartyl-tRNA synthetase

Gene Start:
1454445

Gene Stop:
1452898

Gene Length:
1548

Molecular Weight*:
58208

pI*:
5.10

Net Charge*:
-12.39

EC:
6.1.1.12  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Alanine and aspartate metabolism
Aminoacyl-tRNA biosynthesis

Comment:
Oklahoma ID: NGO.1489c

Internal stop codon? See NG1490.

For other 'asp' genes', see NG0556 (aspA), NG1452 (aspC) and NG1490 (aspS).

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to aspRS sequences. Residues 1-509 are 62% similar to SYD_PSEAE (gb|AAG04352).

Residues 1-515 are virtually identical to NMB0466 in N.meningitidis (gb|AAF40903).

COGS Summary:  COGS Search
BeTs to 13 clades of COG0173
COG name: Aspartyl-tRNA synthetase
Functional Class:  J
The phylogenetic pattern of COG0173 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 312-449 are 56% similar to a (SYNTHETASE PROTEIN LIGASE ASPARTATE--TRNA) protein domain (PD006889) which is seen in SYD_ECOLI.

Residues 90-154 are 89% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000871) which is seen in SYD_HAEIN.

Residues 450-482 are 81% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000848) which is seen in SYD_AQUAE.

Residues 3-89 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002022) which is seen in SYD_BACSU.

Residues 158-291 are 52% similar to a (SYNTHETASE PROTEIN LIGASE ASPARTATE--TRNA) protein domain (PD037346) which is seen in SYD_HAEIN.

Residues 157-312 are 29% similar to a (PROTEIN ORF PUTATIVE KINASE) protein domain (PD000146) which is seen in SYD_BORBU.



Paralogs:  Local Blast Search


NG1489 is paralogously related to NG1454 (lysyl-tRNA synthetase (LysRS)) (1e-11).


Pfam Summary:  Pfam Search
Residues 32 to 482 (E-value = 1.5e-16) place NG1489 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)
Residues 222 to 325 (E-value = 1.5e-38) place NG1489 in the GAD family which is described as GAD domain (PF02938)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1EQR|1EQR-A CRYSTAL STRUCTURE OF FREE ASPARTYL-TRNA 581.0 0e+00
pdb|1C0A|1C0A-A CRYSTAL STRUCTURE OF THE E. COLI ASPARTYL-TRNA 578.0 0e+00
pdb|1EFW|1EFW-A CRYSTAL STRUCTURE OF ASPARTYL-TRNA SYNTHETASE 461.0 0e+00
pdb|1B8A|1B8A-A ASPA

Gene Protein Sequence:
MISGKIEILAKEIEVLNAAATPPFQIDDENISENVRLTNRVIDLRRPVMQ
RNLRLRYQVATGVRRYLDAQGFIDIETPMLTRSTPEGARDYLVPSRVHPG
EFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLE
TSFLNEDEIMDITEGMAKQVFKDALNVDLGDFPRMPYSEAMFYYGSDKPD
MRINLKFTELTDLMKTEEFKVFRGAADMKGGRVVALRVPNGAKFSRKEID
EYTKFVGIYGAKGLAYIKVNDAGNLSNGEDSGLQSPIVKFLSENALKEII
ERTAAQNGDIIFFGADKAKVVNEAVGALRIKVGLEHGKDNGYFTDEWKPL
WVVDFPMFEYDEEADRYVAVHHPFTAPKEGHEDLMVSDPANCLARAYDMV
LNGWEIGGGSIRIHRADVQGKVFAALKISPEEQQEKFGFLLDNLKFGAPP
HGGLAFGLDRLVTLMTGAESIRDVIAFPKTQRAQCLLTDAPNSVDDKQLR
ELSLRLRQKAVETKEA

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTTCCGGCAAAATCGAGATTCTTGCCAAAGAAATCGAAGTGTTGAA
CGCCGCCGCTACGCCGCCGTTCCAAATCGACGACGAAAACATCAGCGAAA
ACGTGCGCCTGACCAACCGCGTTATCGACCTGCGCCGCCCTGTGATGCAG
CGCAACCTGCGCCTGCGTTACCAAGTCGCTACGGGCGTTCGCCGTTATCT
GGACGCGCAAGGCTTCATCGACATCGAAACGCCGATGCTGACCCGCTCCA
CTCCGGAAGGCGCGCGCGACTACCTCGTACCGAGCCGCGTTCATCCGGGC
GAGTTTTTCGCGCTGCCGCAATCGCCGCAATTATTCAAACAACTGTTGAT
GGTGGCGGGTTTCGACCGTTACTACCAAATCACCAAGTGCTTCCGTGACG
AAGACTTGCGCGCCGACCGCCAACCTGAATTCACTCAAATCGACTTGGAA
ACCTCGTTCCTGAACGAGGATGAAATCATGGACATCACTGAAGGCATGGC
CAAACAAGTCTTCAAAGATGCTTTGAACGTAGATTTGGGCGACTTCCCAC
GCATGCCTTATTCTGAAGCCATGTTCTACTACGGCTCTGACAAACCGGAC
ATGCGCATCAACTTAAAATTCACCGAGTTGACCGACCTGATGAAAACGGA
AGAATTCAAAGTCTTCCGTGGCGCAGCCGACATGAAAGGCGGCCGCGTAG
TCGCTCTGCGCGTGCCTAACGGCGCCAAATTCAGCCGCAAAGAAATCGAC
GAATACACTAAATTTGTCGGCATCTACGGCGCGAAAGGTCTGGCATACAT
CAAAGTAAACGATGCGGGCAACCTCTCCAACGGCGAAGACAGCGGCCTGC
AATCTCCAATCGTAAAATTCTTGTCTGAAAACGCCCTGAAAGAAATCATC
GAGCGTACCGCCGCGCAAAACGGCGACATCATCTTCTTCGGTGCGGACAA
AGCCAAAGTCGTGAACGAAGCCGTCGGCGCATTGCGTATCAAAGTCGGCT
TGGAACACGGCAAAGACAACGGCTACTTCACAGACGAATGGAAACCTTTG
TGGGTTGTCGATTTCCCGATGTTCGAATACGACGAAGAAGCCGACCGCTA
CGTTGCCGTACACCATCCGTTTACCGCTCCTAAAGAAGGTCATGAAGACC
TGATGGTTTCCGATCCTGCAAACTGCCTGGCCCGTGCCTACGATATGGTA
TTGAACGGCTGGGAAATCGGCGGAGGCTCTATCCGTATCCACCGTGCAGA
CGTACAAGGGAAAGTGTTTGCCGCGCTGAAAATCAGCCCTGAAGAGCAAC
AAGAGAAATTCGGCTTCCTCTTGGACAACCTGAAATTCGGTGCGCCTCCT
CACGGCGGCCTTGCATTCGGCCTCGACCGTCTGGTAACGCTGATGACCGG
TGCCGAATCCATCCGCGACGTGATTGCCTTCCCGAAAACACAACGCGCCC
AATGCCTGCTGACCGATGCGCCCAACAGCGTGGACGATAAGCAGTTGCGT
GAATTGAGCCTGCGTCTGCGTCAAAAAGCAGTTGAAACAAAAGAAGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy