Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1217 IGR1218 IGR1214 IGR1219 IGR1216 IGR1215 IGR1213 IGR1212 IGR1211 aspS, - NG1490 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 NG1484 aspS, - NG1490 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 NG1484 aspS, - NG1490 NG1488 NG1491 speB, - NG1486 pldA, - NG1492 NG1485 aspS, - NG1489 speA, - NG1487 NG1484
* Calculated from Protein Sequence

Gene ID: NG1487

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
speA  

Definition:
arginine decarboxylase

Gene Start:
1452294

Gene Stop:
1450405

Gene Length:
1890

Molecular Weight*:
71044

pI*:
5.70

Net Charge*:
-18.48

EC:
4.1.1.19  

Functional Class:
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Arginine and proline metabolism
Glutamate metabolism

Secondary Evidence:
Moore,R.C. and Boyle,S.M.
Nucleotide sequence and analysis of the speA gene encoding
biosynthetic arginine decarboxylase in Escherichia coli. J. Bacteriol. 172 (8), 4631-4640 (1990)
Medline: 90330576


Comment:
Oklahoma ID: NGO.1487c

This enzyme is involved in polyamine biosynthesis.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to arginine decarboxylase sequences. Residues 11-630 are 68% similar to SPEA_ECOLI (gb|AAA24646).

Residues 1-630 are virtually identical to NMA2017 in N.meningitidis (AL162757).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1166
COG name: Arginine decarboxylase (spermidine biosynthesis)
Functional Class:  E
The phylogenetic pattern of COG1166 is -------Ce---uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000183 (Orn/DAP/Arg decarboxylases family 2) with a combined E-value of 1.6e-39.
    IPB000183A    98-142
    IPB000183B    202-216
    IPB000183C    238-249
    IPB000183D    271-290
    IPB000183E    329-352
    IPB000183F    495-504
    IPB000183G    529-549


ProDom Summary:  Protein Domain Search
Residues 458-559 are 78% similar to a (ARGININE DECARBOXYLASE LYASE ADC) protein domain (PD005416) which is seen in SPEA_ECOLI.

Residues 96-353 are 72% similar to a (DECARBOXYLASE LYASE BIOSYNTHESIS PYRIDOXAL PHOSPHATE) protein domain (PD001258) which is seen in SPEA_ECOLI.

Residues 11-95 are 51% similar to a (BIOSYNTHETIC ARGININE DECARBOXYLASE EC) protein domain (PD115590) which is seen in SPEA_ECOLI.

Residues 361-457 are 55% similar to a (BIOSYNTHETIC ARGININE DECARBOXYLASE EC) protein domain (PD214555) which is seen in SPEA_ECOLI.

Residues 564-630 are 56% similar to a (BIOSYNTHETIC ARGININE DECARBOXYLASE EC) protein domain (PD123389) which is seen in SPEA_ECOLI.



Paralogs:  Local Blast Search


NG1487 is paralogously related to NG2098 (diaminopimelate decarboxylase (LysA)) (2e-07).


Pfam Summary:  Pfam Search
Residues 70 to 340 (E-value = 8.1e-91) place NG1487 in the Orn_Arg_deC_N family which is described as Pyridoxal-dependent decarboxylase, pyridoxal binding domain (PF02784)
Residues 343 to 560 (E-value = 4.5e-53) place NG1487 in the Orn_DAP_Arg_deC family which is described as Pyridoxal-dependent decarboxylase, C-terminal sheet domain (PF00278)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1F3T|1F3T-A CRYSTAL STRUCTURE OF TRYPANOSOMA BRUCEI 41.4 5e-04

Gene Protein Sequence:
MPILTIREVCNINHWSIGYYDVDDSGEIIVRPNPSQHNQTVSLQKLTEAV
QQKHQARLPVLFCFPQILEHRLRDINRAFQTAREECGYKGGYCLVYPIKV
NQHRRVIESLMSSGQPHGLEAGSKAELMAVLAHAGTRQTLIVCNGYKDRE
YIRFALMGEKLGHQVYLVIEKLSEIQMVLEEAEKLGIKPRLGVRARLASQ
GSGKWQSSGGEKSKFGLSASQVLQLVDILKQKNRLDCLQLLHFHLGSQLG
NIRDVATGVHESARFYVELHKLGVNIRCFDVGGGLGVDYEGNRTQSDCSV
NYSLNEYAATVVWGISQACLEHGLPHPTIITESGRGITAHHAVLVANVIG
VERYKPRRLDAPSPEAPRVLHSMWETWTDISASREKRSLRSWIHEGQFDL
ADVHNQYNVGLLSLAQRAWAEQLYLNICHEVGELFNEKHRSHRTIIDELQ
ERFADKLYVNFSLFQSLPDAWGIDQLFPVCPITGLNEPIARRAVLLDITC
DSDGTIDHYIDGDGIAGTMPMPDYPEEEPPFLGFFMVGAYQEILGNMHNL
FGDTATADVVVREDGQFTVIDYDEGNTVADMLEYVYQDPKELMKRYREQI
EHSDLPASQAMSFLKELEAGLNGYTYLEDE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTATCCTTACCATCCGTGAAGTGTGCAACATTAATCATTGGAGCAT
AGGTTATTATGATGTTGACGATTCCGGCGAAATCATCGTCCGCCCCAATC
CCTCGCAACACAATCAAACTGTTTCACTGCAAAAACTGACTGAAGCCGTG
CAACAAAAACATCAGGCGCGCCTGCCTGTTTTGTTTTGTTTTCCGCAAAT
CCTCGAACACCGCCTCCGCGACATTAACCGCGCCTTTCAGACGGCACGGG
AAGAGTGCGGCTATAAGGGCGGTTATTGTTTGGTTTACCCTATCAAGGTC
AACCAACACCGCCGCGTCATCGAGTCGCTTATGTCAAGCGGACAACCGCA
TGGTTTGGAAGCCGGTTCTAAAGCCGAACTGATGGCGGTTTTGGCACACG
CCGGCACCCGGCAAACATTAATCGTCTGCAACGGCTATAAAGACCGTGAA
TATATCCGTTTCGCCTTGATGGGCGAAAAACTGGGGCATCAGGTTTATTT
GGTGATTGAGAAGCTGTCCGAAATACAAATGGTATTGGAAGAGGCGGAAA
AACTCGGCATCAAGCCCCGTTTGGGTGTGCGCGCCAGACTGGCTTCCCAA
GGTTCGGGAAAATGGCAGTCTTCGGGTGGGGAAAAATCAAAATTCGGCTT
GTCGGCTTCCCAAGTTTTGCAACTGGTCGATATTTTGAAACAAAAAAACA
GGCTGGACTGCCTGCAGCTTTTGCATTTCCATTTGGGCTCGCAGCTTGGG
AACATCCGTGATGTTGCCACAGGTGTACACGAATCGGCTCGGTTTTATGT
TGAGTTGCACAAACTGGGGGTAAATATCCGCTGTTTTGATGTAGGTGGCG
GGCTTGGCGTGGATTACGAAGGAAACCGCACACAATCGGATTGTTCCGTT
AATTACAGCCTGAACGAATATGCCGCCACAGTCGTATGGGGCATCAGTCA
GGCTTGTCTCGAACACGGGCTGCCGCATCCGACAATCATTACCGAGAGCG
GGCGCGGCATTACCGCACATCACGCCGTTTTGGTTGCTAATGTTATAGGC
GTTGAACGTTACAAACCGCGTCGGCTGGATGCGCCATCGCCCGAAGCACC
GCGTGTGTTGCACAGTATGTGGGAAACTTGGACGGATATTTCCGCCTCGC
GGGAAAAACGTTCCTTACGCAGCTGGATACACGAAGGGCAGTTTGATCTT
GCCGATGTGCATAATCAGTATAATGTCGGGCTGTTGAGTTTGGCGCAACG
TGCGTGGGCGGAGCAACTGTATTTAAATATCTGTCATGAAGTCGGCGAAT
TGTTTAATGAAAAACACCGGTCTCACCGAACCATTATTGACGAATTGCAA
GAACGTTTTGCCGATAAGCTGTATGTCAATTTCTCACTCTTCCAATCTTT
GCCCGATGCTTGGGGCATAGATCAACTTTTCCCTGTTTGTCCTATTACCG
GTTTGAATGAACCGATTGCGCGCCGCGCCGTGTTGTTGGACATTACCTGC
GATTCAGACGGTACGATTGACCACTACATCGACGGCGACGGCATCGCCGG
TACGATGCCTATGCCTGATTATCCCGAAGAAGAGCCGCCGTTTTTAGGCT
TTTTTATGGTGGGAGCATATCAGGAAATACTCGGCAATATGCACAATCTT
TTCGGCGACACTGCCACTGCTGATGTTGTTGTAAGGGAAGACGGACAATT
TACCGTCATCGATTACGATGAAGGAAACACCGTTGCCGATATGCTCGAAT
ACGTTTATCAAGATCCGAAAGAGCTGATGAAACGCTATCGCGAACAAATC
GAACATTCAGACCTTCCTGCCTCGCAGGCTATGTCTTTCTTAAAAGAACT
CGAAGCGGGGCTTAATGGTTATACCTATTTGGAAGACGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy