Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1217 IGR1210 IGR1218 IGR1214 IGR1216 IGR1215 IGR1213 IGR1212 IGR1211 aspS, - NG1490 NG1488 NG1482 NG1491 speB, - NG1486 bioF, - NG1483 NG1485 aspS, - NG1489 speA, - NG1487 NG1484 aspS, - NG1490 NG1488 NG1482 NG1491 speB, - NG1486 bioF, - NG1483 NG1485 aspS, - NG1489 speA, - NG1487 NG1484 NG1488 NG1491 speB, - NG1486 bioF, - NG1483 NG1485 aspS, - NG1489 speA, - NG1487 aspS, - NG1490 NG1482 NG1484
* Calculated from Protein Sequence

Gene ID: NG1486

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
speB  

Definition:
agmatine ureohydrolase; secreted cysteine protease

Gene Start:
1450303

Gene Stop:
1449383

Gene Length:
921

Molecular Weight*:
33952

pI*:
5.60

Net Charge*:
-7.01

EC:
3.5.3.11  

Functional Class:
Cellular processes; Protein and peptide secretion  
Central intermediary metabolism; Nitrogen metabolism  

Pathway: pathway table
Arginine and proline metabolism

Secondary Evidence:
Szumanski,M.B. and Boyle,S.M.
Analysis and sequence of the speB gene encoding agmatine
ureohydrolase, a putrescine biosynthetic enzyme in Escherichia coli.
J. Bacteriol. 172 (2), 538-547 (1990)
M:90130284

Eriksson A, Norgren M.
Cleavage of antigen-bound immunoglobulin G by SpeB contributes to streptococcal persistence in opsonizing blood.
Infect Immun. 2003 Jan;71(1):211-7.
PMID: 12496168


Comment:
Oklahoma ID: NGO.1486c

Blast Summary:  PSI-Blast Search
NG1486 is 100% identical to a previously sequenced N.gonorrhoeae protein in GenBank, 10184435, an unnamed product.

Several matches in gapped BLAST to agmatinase. Residues 3-306 are 76% similar to the SpeE protein in Pasteurella multocida (gb|AAK03465).

Residues 1-307 are virtually identical to NMA2016 in N.meningitidis (gb|AAF40906).

COGS Summary:  COGS Search
BeTs to 9 clades of COG0010
COG name: Arginase/agmatinase/formimionoglutamate hydrolase, arginase family
Functional Class:  E
The phylogenetic pattern of COG0010 is amtky--CeB--uj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000287 (Arginase family) with a combined E-value of 3.2e-63.
    IPB000287A    48-60
    IPB000287B    89-96
    IPB000287C    122-140
    IPB000287D    143-159
    IPB000287E    181-196
    IPB000287F    226-256
    IPB000287G    269-279


ProDom Summary:  Protein Domain Search
Residues 4-38 are 77% similar to a (AGMATINASE EC 3.5.3.11 AGMATINE) protein domain (PD107404) which is seen in SPEB_ECOLI.

Residues 39-279 are 73% similar to a (HYDROLASE ARGINASE MANGANESE METABOLISM ARGININE UREA) protein domain (PD001703) which is seen in SPEB_ECOLI.



Paralogs:  Local Blast Search


NG1486 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 33 to 303 (E-value = 2.2e-110) place NG1486 in the Arginase family which is described as Arginase family (PF00491)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1GQ6|1GQ6-A PROCLAVAMINATE AMIDINO HYDROLASE FROM 195.0 1e-50
pdb|1CEV|1CEV-A ARGINASE FROM BACILLUS CALDOVELOX, NATIVE 88.5 1e-18
pdb|1HQX|1HQX-A R308K ARGINASE VARIANT 80.0 5e-16
pdb|1D3V|1D3V-A CRYS

Gene Protein Sequence:
MQYSTLAGQTDNSLVSNNFGFLRLPLNFMPYESHADWVITGVPYDMAVSG
RSGARFGPEAIRRASVNLAWEHRRFPWTFDVRERLNIIDCGDLVFSFGDS
RDFVEKMEAHAGKLLSFGKRCLSLGGDHFITLPLLRAHARYFGKLALIHF
DAHTDTYDNGSEYDHGTMFYTAPKEGLIDPSRSVQIGIRTEHSKKLPFTV
LSAPKVNEDSVEETVRKIKETVGNMPVYLTFDIDCLDPSFAPGTGTPVCG
GLSSDRALKILRGLTDLDIVGMDVVEVAPSYDQSDITALAGATIALEMLY
LQGAKKD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATACAGCACACTGGCAGGACAAACCGACAACTCCCTCGTTTCCAA
TAATTTCGGGTTTTTGCGCCTGCCGCTTAATTTTATGCCGTATGAAAGCC
ATGCCGATTGGGTTATTACCGGCGTGCCTTATGATATGGCGGTTTCAGGG
CGTTCCGGCGCGCGTTTCGGTCCTGAAGCCATCCGGCGCGCCTCCGTCAA
CCTCGCTTGGGAGCACCGCAGGTTTCCGTGGACATTTGATGTGCGCGAAC
GCCTGAACATTATTGATTGCGGCGACTTGGTTTTTTCTTTTGGCGACAGC
AGGGATTTTGTCGAAAAAATGGAAGCGCACGCCGGCAAATTACTTTCTTT
CGGCAAACGCTGTTTGAGTTTGGGCGGCGACCATTTCATTACCCTCCCGT
TGTTGCGCGCCCACGCCCGCTATTTCGGCAAACTCGCACTGATTCATTTT
GACGCGCACACCGACACCTACGACAACGGCAGCGAATACGACCACGGCAC
GATGTTTTATACCGCCCCCAAGGAAGGCCTCATCGACCCGTCCCGTTCCG
TACAAATCGGCATACGCACCGAACACAGTAAAAAATTGCCTTTTACTGTG
TTGTCCGCCCCCAAAGTCAATGAAGACAGTGTTGAAGAGACCGTCCGTAA
AATCAAAGAAACCGTCGGCAATATGCCCGTTTACCTGACTTTCGACATAG
ACTGTCTCGACCCGTCGTTCGCCCCCGGGACCGGTACGCCCGTATGCGGC
GGCTTGAGCAGCGACAGGGCATTAAAAATCCTACGTGGGCTGACGGATCT
CGACATCGTCGGTATGGATGTTGTAGAAGTTGCCCCCTCTTACGACCAAT
CCGACATTACCGCTTTGGCCGGCGCCACAATTGCCTTGGAAATGCTTTAC
CTTCAAGGTGCGAAAAAGGAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy