Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1209 IGR1210 IGR1214 IGR1207 IGR1213 IGR1212 IGR1211 IGR1208 IGR1209.2 IGR1209.1 NG1478 NG1477 NG1480 NG1480.1 NG1479 bioC, - NG1481 speB, - NG1486 bioF, - NG1483 NG1485 speA, - NG1487 NG1484 NG1478 NG1477 NG1480 NG1480.1 NG1479 bioC, - NG1481 speB, - NG1486 bioF, - NG1483 NG1485 speA, - NG1487 NG1484 NG1477 NG1480.1 NG1479 bioC, - NG1481 speB, - NG1486 bioF, - NG1483 NG1485 speA, - NG1487 NG1482 NG1482 NG1478 NG1480 NG1484
* Calculated from Protein Sequence

Gene ID: NG1483

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioF  

Definition:
8-amino-7oxoanoatesynthase (BioF)

Gene Start:
1446213

Gene Stop:
1445074

Gene Length:
1140

Molecular Weight*:
43088

pI*:
8.20

Net Charge*:
4.66

EC:
2.3.1.47  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Biotin  

Pathway: pathway table
Biotin metabolism

Secondary Evidence:
Bower,S., Perkins,J.B., Yocum,R.R., Howitt,C.L., Rahaim,P. and
Pero,J.
Cloning, sequencing, and characterization of the Bacillus subtilis
biotin biosynthetic operon. J. Bacteriol. 178 (14), 4122-4130 (1996)
Medline: 96312354

Otsuka,A.J., Buoncristiani,M.R., Howard,P.K., Flamm,J., Johnson,C., Yamamoto,R., Uchida,K., Cook,C., Ruppert,J. and Matsuzaki,J.
The Escherichia coli biotin biosynthetic enzyme sequences predicted from the nucleotide sequence of the bio operon
J. Biol. Chem. 263 (36), 19577-19585 (1988)
Medline: 89066784


Comment:
Oklahoma ID: NGO.1483c

For other 'bio' genes, see NG0309 (bioD), NG0813 (bioB), NG1481 (bioC), NG0308 (bioA), NG1725 (bioH).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to 8-amino-7-oxononanoate synthase sequences. Residues 1-380 are 91% similar to BIOF_HAEIN (gb|AAC23202).

Residues 1-380 are virtually identical to NMB0472 in N.meningitidis (gb|AAF40909).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0156
COG name: Biotin biosynthesis protein BioF and related aminotransferases
Functional Class:  H
The phylogenetic pattern of COG0156 is -m-kYq-cEBRhuj----iNx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003408 (Aminolevulinic acid synthase domain) with a combined E-value of 1.2e-19.
    IPB003408C    106-160
    IPB003408D    181-222
    IPB003408E    239-284
    IPB003408F    292-328
    IPB003408G    334-368
***** IPB001917 (Aminotransferases class-II) with a combined E-value of 6.8e-13.
    IPB001917A    68-79
    IPB001917B    126-137
    IPB001917C    200-214


ProDom Summary:  Protein Domain Search
Residues 320-367 are 89% similar to a (SYNTHASE TRANSFERASE ACID BIOSYNTHESIS SYNTHETASE) protein domain (PD001038) which is seen in BIOF_HAEIN.

Residues 279-319 are 85% similar to a (8-AMINO-7-OXONONANOATE SYNTHASE EC 2.3.1.47) protein domain (PD196339) which is seen in BIOF_HAEIN.

Residues 78-278 are 94% similar to a (PYRIDOXAL PHOSPHATE AMINOTRANSFERASE TRANSFERASE PROTEIN) protein domain (PD000087) which is seen in BIOF_HAEIN.

Residues 1-77 are 89% similar to a (8-AMINO-7-OXONONANOATE SYNTHASE EC) protein domain (PD107246) which is seen in BIOF_HAEIN.



Paralogs:  Local Blast Search

NG1483 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 75 to 379 (E-value = 7.2e-59) place NG1483 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1BS0|1BS0-A PLP-DEPENDENT ACYL-COA SYNTHASE 179.0 8e-46
pdb|1DJ9|1DJ9-A CRYSTAL STRUCTURE OF 8-AMINO-7-OXONANOATE 176.0 6e-45
pdb|1FC4|1FC4-A 2-AMINO-3-KETOBUTYRATE COA LIGASE 163.0 5e-41
pdb|1BS0|1BS0-A P

Gene Protein Sequence:
MKVFRQQLEQLGAQNQYRSIPDLIHQGRYITRENRKMLNMSSNDYLGLAS
DENLRRSFLQQYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESA
LLFNSGYHANLGILPALTTTKSLILADKFVHASMIDGIRLSRCAFFRYRH
NDYEHLKNLLEKNVGKFDRTFIVTESVFSMDGDVADLKQLVQLKKQFPNT
YLYVDEAHAIGVYGQNGLGIAERDNLIAEIDLLVGTFGKALASVGAYAVC
NQVLKECLINQMRPLIFSTALPPFNVAWTYFIFERLPQFSKERSHLEQLS
AFLRREVAHRTQIMPSETCIVPYILGGNEATLAKAEYLQGQGYYCLPIGP
PTVPKNTSRIRLSLTADMTTDEVRQFAACL

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAGTTTTTAGACAACAGCTTGAACAACTCGGCGCGCAAAATCAATA
TCGTTCGATTCCGGATTTGATTCATCAAGGGCGGTATATTACACGGGAAA
ACCGCAAAATGCTGAATATGTCGTCTAATGATTATTTGGGGTTGGCATCA
GATGAAAACTTACGCCGGTCTTTTTTGCAGCAATACGGCGGTAATTTTCC
CTCTTTTACCAGTTCTTCATCACGTTTATTAACGGGCAACTTTCCTATTT
ATACCGATTTGGAAGAGCTTGTCGCACAACGTTTCCAACGGGAAAGCGCG
TTATTGTTCAACAGCGGCTATCACGCCAATCTCGGTATTTTGCCTGCTTT
GACGACGACGAAAAGTTTGATTTTGGCAGATAAATTCGTTCACGCCAGTA
TGATTGACGGCATCCGTTTGAGCCGGTGTGCGTTTTTCCGTTATCGTCAT
AATGATTATGAACATTTGAAAAATCTGCTTGAAAAAAACGTCGGAAAATT
TGACCGCACTTTTATCGTTACCGAATCTGTTTTCAGTATGGACGGCGATG
TGGCGGATTTGAAACAGCTTGTCCAATTAAAAAAACAGTTTCCCAATACT
TATCTTTATGTGGATGAAGCCCACGCAATCGGTGTTTATGGGCAAAACGG
ATTGGGGATTGCCGAACGGGATAATCTGATTGCCGAGATTGATTTATTGG
TCGGCACTTTCGGTAAAGCCTTAGCCTCGGTGGGGGCGTATGCCGTCTGC
AACCAAGTATTGAAAGAATGTTTGATTAATCAAATGCGCCCATTGATTTT
TTCAACCGCATTGCCGCCGTTTAATGTGGCTTGGACTTATTTTATTTTTG
AACGATTGCCGCAATTCTCAAAAGAAAGAAGTCATCTTGAGCAGTTAAGC
GCATTTTTACGGCGGGAAGTGGCGCATCGGACGCAAATAATGCCGAGCGA
AACCTGTATCGTCCCCTATATTTTAGGCGGGAATGAAGCCACCCTTGCCA
AAGCGGAATATCTGCAAGGTCAGGGTTATTATTGCCTGCCCATCGGACCG
CCGACAGTACCAAAAAACACATCCAGAATCCGCCTGTCTTTAACTGCCGA
TATGACAACGGATGAAGTTCGGCAGTTTGCGGCGTGCCTG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy