Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap tRNA-Asn-2 IGR1200 IGR1205 IGR1198 IGR1201 IGR1199 IGR1206 IGR1207 IGR1202 IGR1203 IGR1204 NG1478 NG1475 NG1477 NG1476 mdaB, - NG1473 serB, - NG1468 NG1467 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 NG1478 NG1475 NG1477 NG1476 mdaB, - NG1473 serB, - NG1468 NG1467 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 NG1478 NG1476 mdaB, - NG1473 serB, - NG1468 NG1467 NG1475 NG1477 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470
* Calculated from Protein Sequence

Gene ID: NG1472

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pntB  

Definition:
NAD(P) transhydrogenase beta subunit

Gene Start:
1435328

Gene Stop:
1436710

Gene Length:
1383

Molecular Weight*:
48483

pI*:
5.60

Net Charge*:
-7.72

EC:
1.6.1.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Ahmad,S., Glavas,N.A. and Bragg,P.D.
A mutation at Gly314 of the beta subunit of the Escherichia coli
pyridine nucleotide transhydrogenase abolishes activity and affects the NADP(H)-induced conformational
change.
Eur. J. Biochem. 207 (2), 733-739 (1992)
M: 92339464

Hickman JW, Barber RD, Skaar EP, Donohue TJ.
Link between the membrane-bound pyridine nucleotide transhydrogenase and glutathione-dependent processes in
Rhodobacter sphaeroides.
J Bacteriol. 2002 Jan;184(2):400-9.
PMID: 11751816

Anderlund M, Nissen TL, Nielsen J, Villadsen J, Rydström J, Hahn-Hägerdal B, Kielland-Brandt MC.
Expression of the Escherichia coli pntA and pntB genes, encoding nicotinamide nucleotide transhydrogenase,
in Saccharomyces cerevisiae and its effect on product formation during anaerobic glucose fermentation.
Appl Environ Microbiol. 1999 Jun;65(6):2333-40.
PMID: 10347010

Clarke DM, Loo TW, Gillam S, Bragg PD.
Nucleotide sequence of the pntA and pntB genes encoding the pyridine nucleotide transhydrogenase of
Escherichia coli.
Eur J Biochem. 1986 Aug;158(3):647-53.
PMID: 3525165

Comment:
Oklahoma ID: NGO.1472

For the PntA subunit protein, see NG1470.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to PntB sequences. Residues 1-459 are 71% similar to the PntB in V.cholerae (gb|AAF96466).

Residues 1-461 are virtually identical to NMB0978 in N.meningitidis (gb|AAF41382).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1282
COG name: NAD(P)+ transhydrogenase, beta subunit
Functional Class:  C
The phylogenetic pattern of COG1282 is -------ce-rh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB004003 (NAD(P) transhydrogenase beta subunit) with a combined E-value of 0.
    IPB004003A    14-46
    IPB004003B    63-96
    IPB004003C    125-178
    IPB004003D    190-235
    IPB004003E    236-269
    IPB004003F    298-342
    IPB004003G    343-383
    IPB004003H    384-421
    IPB004003I    422-455
    IPB004003B    190-223
    IPB004003D    63-108


ProDom Summary:  Protein Domain Search
Residues 1-459 are 70% similar to a (TRANSHYDROGENASE NUCLEOTIDE NADP PYRIDINE) protein domain (PD005076) which is seen in PNTB_ECOLI.



Paralogs:  Local Blast Search


NG1472 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
30
cleavable N-terminal sequence  
1  
23
transmembrane  
34  
50
transmembrane  
56  
72
transmembrane  
86  
102
transmembrane  
119  
135
non-globular  
121  
317
transmembrane  
164  
180
transmembrane  
186  
202
transmembrane  
236  
252

PDB Hit:
pdb|1DJL|1DJL-A THE CRYSTAL STRUCTURE OF HUMAN TRANSHYDROGENASE 242.0 8e-65
pdb|1D4O|1D4O-A CRYSTAL STRUCTURE OF TRANSHYDROGENASE DOMAIN III238.0 2e-63
pdb|1DJL|1DJL-A THE CRYSTAL STRUCTURE OF HUMAN TRANSHYDROGENASE 331.0 1e-91
pdb|1D4O|1D4O-A CRYS

Gene Protein Sequence:
MSSGLVTAAYIVAAILFIFSLAGLSKQETAKRGCYSGIAGMAVALFVTVF
SDNTHGLGWIIIAMLIGAAIGIHKAKKVEMTEMPELIALLHSFVGLAAVL
VGFNSYIEPGNVSHDMHTIHLVEVYLGIFIGAVTFTGSLAAFGKLNGKIS
SSPLQLPAKHKLNALALAVSFVLLLVFVGIDGSGFILLIMTLIALAFGWH
LVASIGGADMPVVVSMLNSYSGWAAAAAGFMLSNDLLIVTGALVGSSGAI
LSYIMCKAMNRSFVSVIAGGFGSDSGISSSGSQEIEEYREVKAADVAEML
KGASSVIITPGYGMAVAQAQYPVAEITELLRKNGIEVRFGIHPVAGRLPG
HMNVLLAEAKVPYDIVLEMDEINDDFPETDVVLVIGANDTVNPAAQTDPN
SPIAGMPVLEVWKAKEVVVFKRSMNTGYAGVQNPLFFNENSVMCFGDAKK
TVDGILAELKK

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTCAGGACTCGTAACAGCGGCGTATATCGTTGCCGCAATTTTATT
CATCTTCTCACTGGCGGGGCTGTCCAAACAGGAAACCGCCAAACGGGGCT
GCTATTCCGGTATCGCCGGTATGGCGGTCGCCCTCTTCGTAACGGTCTTT
TCCGACAATACCCACGGACTGGGCTGGATTATCATCGCCATGCTCATCGG
CGCGGCAATCGGCATCCACAAAGCCAAAAAAGTAGAAATGACCGAAATGC
CCGAACTGATTGCACTTCTGCACAGCTTCGTCGGCTTGGCAGCCGTTTTG
GTCGGCTTCAACAGCTACATCGAGCCGGGCAACGTTTCGCACGATATGCA
CACCATCCATCTGGTCGAAGTCTATTTGGGCATTTTCATCGGCGCGGTAA
CCTTTACCGGCTCACTGGCCGCATTCGGCAAACTCAACGGCAAAATCAGC
AGCAGCCCGCTGCAACTGCCCGCCAAACACAAGCTCAACGCACTGGCGCT
CGCCGTATCGTTTGTGTTGCTGCTCGTATTTGTCGGCATTGACGGCAGCG
GCTTCATCCTTCTGATTATGACCCTGATCGCCCTCGCATTCGGCTGGCAC
TTGGTTGCCTCCATCGGCGGCGCGGATATGCCCGTGGTCGTATCTATGCT
CAACTCCTACTCCGGCTGGGCGGCCGCAGCGGCAGGCTTTATGCTCTCCA
ACGACCTGCTCATCGTTACCGGCGCGCTGGTCGGCTCAAGCGGCGCAATT
CTGTCCTACATTATGTGCAAAGCCATGAATCGGTCGTTTGTTTCCGTGAT
TGCCGGCGGTTTCGGCAGCGACAGCGGCATATCGTCTTCCGGCAGCCAAG
AGATAGAGGAATACCGAGAAGTCAAAGCTGCCGATGTTGCCGAAATGCTG
AAAGGCGCAAGCAGCGTCATTATCACCCCGGGCTACGGCATGGCAGTGGC
GCAGGCACAATACCCCGTTGCCGAAATCACCGAGCTTTTGCGTAAAAACG
GCATCGAAGTACGCTTCGGCATCCACCCCGTCGCCGGCCGCCTGCCCGGT
CATATGAATGTACTGCTCGCCGAAGCCAAAGTCCCCTACGACATTGTTTT
GGAAATGGACGAAATCAACGACGACTTCCCCGAAACCGATGTGGTCTTGG
TGATTGGTGCGAACGATACCGTCAACCCTGCCGCCCAAACCGATCCGAAC
AGCCCGATTGCAGGTATGCCGGTTTTAGAAGTATGGAAGGCAAAAGAAGT
CGTCGTATTCAAACGCTCGATGAACACCGGCTACGCAGGCGTACAAAACC
CGCTGTTCTTCAACGAAAACAGCGTGATGTGTTTCGGCGACGCGAAGAAA
ACCGTTGACGGGATTTTGGCGGAATTGAAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy