Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1200 IGR1196 IGR1198 IGR1201 IGR1199 IGR1197 IGR1202 IGR1203 IGR1204 NG1465 mdaB, - NG1473 serB, - NG1468 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 NG1465 mdaB, - NG1473 serB, - NG1468 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 NG1465 mdaB, - NG1473 serB, - NG1468 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470
* Calculated from Protein Sequence

Gene ID: NG1470

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pntA  

Definition:
NADP transhydrogenase, alpha subunit (PntA)

Gene Start:
1433323

Gene Stop:
1434858

Gene Length:
1536

Molecular Weight*:
53766

pI*:
8.20

Net Charge*:
2.80

EC:
1.6.1.1  

Functional Class:
Energy metabolism; Electron transport  

Pathway: pathway table
Nicotinate and nicotinamide metabolism

Secondary Evidence:
Ahmad,S., Glavas,N.A. and Bragg,P.D.
A mutation at Gly314 of the beta subunit of the Escherichia coli
pyridine nucleotide transhydrogenase abolishes activity and affects the NADP(H)-induced conformational change.
Eur. J. Biochem. 207 (2), 733-739 (1992)
M: 92339464

Hickman JW, Barber RD, Skaar EP, Donohue TJ.
Link between the membrane-bound pyridine nucleotide transhydrogenase and glutathione-dependent processes in Rhodobacter sphaeroides.
J Bacteriol. 2002 Jan;184(2):400-9.
PMID: 11751816

Anderlund M, Nissen TL, Nielsen J, Villadsen J, Rydström J, Hahn-Hägerdal B, Kielland-Brandt MC.
Expression of the Escherichia coli pntA and pntB genes, encoding nicotinamide nucleotide transhydrogenase, in Saccharomyces cerevisiae and its effect on product formation during anaerobic glucose fermentation.
Appl Environ Microbiol. 1999 Jun;65(6):2333-40.
PMID: 10347010

Clarke DM, Loo TW, Gillam S, Bragg PD.
Nucleotide sequence of the pntA and pntB genes encoding the pyridine nucleotide transhydrogenase of Escherichia coli.
Eur J Biochem. 1986 Aug;158(3):647-53.
PMID: 3525165

Comment:
Oklahoma ID: NGO.1470

For the PntB protein, see NG1472.

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to NAD(P) transhydrogenase, alpha chain sequences. Residues 1-511 are 61% similar to the NAD(P) transhydrogenase, alpha subunit of Vibrio cholerae (gb|AAF96465).

Residues 1-512 are greater than 90% similar to NMB0980 in N.meningitidis (gb|AAF41384).

COGS Summary:  COGS Search
BeTs to 6 clades of COG0686
COG name: NAD/NADP transhydrogenase alpha subunit
Functional Class:  C
The phylogenetic pattern of COG0686 is ----y--CebRhuj------X
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB004002 (Alanine dehydrogenase and pyridine nucleotide transhydrogenase) with a combined E-value of 1.4e-80.
    IPB004002A    1-40
    IPB004002B    157-209
    IPB004002C    259-294


ProDom Summary:  Protein Domain Search
Residues 425-511 are 81% similar to a (TRANSHYDROGENASE NUCLEOTIDE NADP PYRIDINE NICOTINAMIDE) protein domain (PD004836) which is seen in PNTA_ECOLI.

Residues 224-290 are 46% similar to a (NAD DEHYDROGENASE OXIDOREDUCTASE PROTEIN HYDROLASE) protein domain (PD000699) which is seen in O85594_BBBBB.

Residues 1-156 are 56% similar to a (OXIDOREDUCTASE TRANSHYDROGENASE DEHYDROGENASE NAD) protein domain (PD002205) which is seen in PNTA_HAEIN.

Residues 157-362 are 69% similar to a (TRANSHYDROGENASE NUCLEOTIDE NADP PYRIDINE NICOTINAMIDE) protein domain (PD005311) which is seen in PNTA_ECOLI.



Paralogs:  Local Blast Search


NG1470 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 137 (E-value = 1.2e-68) place NG1470 in the AlaDh_PNT_N family which is described as Alanine dehydrogenase/PNT, N-terminal domain (PF05222)
Residues 144 to 350 (E-value = 4.3e-105) place NG1470 in the AlaDh_PNT_C family which is described as Alanine dehydrogenase/PNT, C-terminal domain (PF01262)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
65
non-globular  
140  
201
transmembrane  
168  
184
non-globular  
360  
512
transmembrane  
404  
420
transmembrane  
423  
439
transmembrane  
454  
470
transmembrane  
479  
495

PDB Hit:
pdb|1F8G|1F8G-A THE X-RAY STRUCTURE OF NICOTINAMIDE NUCLEOTIDE 275.0 9e-75
pdb|1PJC|1PJC-A 326.0 7e-90

Gene Protein Sequence:
MKIGIPRESLSGETRVACTPATVALLGKLGFETVVESGAGLAASLDDAAY
QTAGATVADKAAVWACPLIYKVNAPSEGELPLLKEGQTIVSFLWPRQNEA
LVEALRAKKVNALAMDMVPRISRAQALDALSSMANISGYRAVIEAANAFG
RFFTGQITAAGKVPPAQVLVIGAGVAGLAAIGTANSLGAVVRAFDTRLEV
AEQIESMGGKFLKLDFLQESGGSGDGYAKVMSDEFIAAEMKLFAEQAKEV
DIIITTAAIPGKPAPKLITKEMVESMKSGSVIVDLAATGGNCELTRPGEL
SVTGNGVKIIGYTDMANRLAGQSSQLYATNLVNLTKLLSPNKDGEITLDF
EDVIIRNMTVTRDGEITFPPPPIQVSARPQQTPSEKAAPAAKPEPKPVPL
WKKLAPAAIAAVLVLWVRAVAPAAFLNHFIVFVLACVIGYHVVWNVSHSL
HTPLMSVTNAISGIIVVGALLQIGQGNGFVSLLSFVAILIAGINIFGGFA
VTRRMLNMFKKG

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATCGGTATCCCACGCGAGTCATTATCCGGCGAAACCCGCGTCGC
CTGCACGCCCGCCACCGTTGCCCTGCTGGGCAAACTAGGCTTTGAAACCG
TTGTCGAAAGCGGTGCAGGTTTGGCGGCAAGTTTGGACGATGCCGCTTAC
CAAACAGCAGGCGCAACCGTTGCCGACAAAGCGGCGGTTTGGGCCTGCCC
TTTAATTTATAAGGTCAACGCGCCGTCCGAAGGCGAGCTGCCGCTGCTCA
AAGAAGGTCAAACCATCGTCAGCTTCCTGTGGCCGCGCCAAAACGAGGCT
TTGGTCGAGGCCTTGCGCGCCAAGAAAGTCAACGCGCTGGCGATGGACAT
GGTTCCCCGCATTTCCCGCGCTCAGGCCTTGGACGCTTTGTCTTCAATGG
CAAACATCAGCGGCTACCGCGCCGTGATTGAAGCCGCCAACGCCTTCGGC
CGTTTCTTCACCGGTCAAATCACTGCCGCCGGCAAAGTGCCGCCTGCGCA
GGTTTTGGTGATTGGCGCCGGTGTGGCGGGTTTGGCGGCAATCGGTACGG
CAAATTCGCTCGGCGCAGTGGTGCGCGCGTTCGATACCCGCTTGGAAGTG
GCGGAACAAATCGAATCGATGGGCGGTAAGTTCCTGAAACTCGACTTCCT
GCAAGAATCGGGCGGCAGCGGAGACGGCTACGCCAAAGTGATGAGCGACG
AATTTATCGCCGCCGAAATGAAGCTCTTTGCCGAACAGGCGAAAGAAGTG
GACATCATCATCACCACCGCCGCCATTCCGGGCAAACCCGCTCCCAAGCT
GATTACCAAAGAAATGGTGGAAAGCATGAAATCCGGATCCGTCATCGTCG
ATTTGGCGGCGACGGGCGGCAACTGCGAACTCACCCGACCGGGCGAATTG
TCCGTAACCGGCAACGGCGTGAAAATCATCGGCTACACCGACATGGCAAA
CCGCCTTGCCGGACAGTCTTCCCAGCTTTACGCCACCAACTTGGTGAACC
TGACCAAGCTGTTAAGCCCGAACAAAGACGGCGAAATCACGCTGGACTTC
GAAGACGTGATTATCCGCAATATGACCGTTACCCGCGACGGCGAAATCAC
CTTCCCGCCTCCGCCGATTCAGGTTTCCGCCCGGCCGCAGCAAACGCCGT
CTGAAAAAGCCGCGCCTGCCGCCAAGCCCGAGCCGAAACCTGTTCCCCTG
TGGAAAAAACTCGCGCCCGCCGCCATCGCCGCCGTATTGGTGCTGTGGGT
CCGCGCGGTCGCACCCGCAGCATTCTTGAACCACTTTATCGTCTTCGTCC
TCGCCTGCGTCATCGGCTACCATGTCGTTTGGAACGTCAGCCACTCGCTG
CACACACCGCTGATGTCGGTAACCAACGCCATCTCCGGCATCATCGTCGT
CGGCGCGCTGCTGCAAATCGGTCAGGGCAACGGCTTCGTTTCGCTGCTGT
CGTTTGTTGCCATCCTGATTGCCGGCATCAATATCTTCGGCGGCTTTGCG
GTTACACGGCGTATGCTGAATATGTTTAAGAAAGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy