Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1200 IGR1196 IGR1198 IGR1201 IGR1199 IGR1197 IGR1202 IGR1203 IGR1195 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470 Type: tandem, Name:  - 67 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 crgA, - NG1474 pntB, - NG1472 pntA, - NG1470
* Calculated from Protein Sequence

Gene ID: NG1469

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Neisseria-specific protein, uncharacterized

Gene Start:
1433011

Gene Stop:
1433205

Gene Length:
195

Molecular Weight*:
7528

pI*:
10.80

Net Charge*:
8.13

EC:
 

Functional Class:
Neisseria-specific protein  
Unknown  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1469

Check start codon.

Blast Summary:  PSI-Blast Search
Single match in gapped BLAST to NMA1178 in N.meningitidis (AL162755), a hypothetical. Residues 24-50 are 96% similar to residues 1-27 of NMA1178.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1469 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LEDEGLRHNGGSKNADYIVKRQRMLRRACLQSENDFKRKRQYVSDNTGKC
ATIASLMKIRYKGII

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAGGACGAGGGCTTGCGGCATAACGGCGGCTCAAAAAATGCGGATTA
TATAGTGAAACGGCAAAGAATGTTACGGCGGGCGTGCCTGCAATCGGAAA
ACGACTTCAAACGCAAACGGCAGTATGTGTCGGACAACACGGGAAAATGC
GCAACTATTGCCAGCCTGATGAAAATTCGTTATAAGGGGATTATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy