Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1200 IGR1196 IGR1198 IGR1201 IGR1199 IGR1197 IGR1194 IGR1202 IGR1203 IGR1195 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 pntB, - NG1472 pntA, - NG1470 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 pntB, - NG1472 pntA, - NG1470 Type: tandem, Name:  - 66 Type: tandem, Name:  - 67 NG1465 mdaB, - NG1473 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1471 pntB, - NG1472 pntA, - NG1470
* Calculated from Protein Sequence

Gene ID: NG1468

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
serB  

Definition:
phosphoserine phosphatase (SerB)

Gene Start:
1433034

Gene Stop:
1432204

Gene Length:
831

Molecular Weight*:
30471

pI*:
5.10

Net Charge*:
-7.16

EC:
3.1.3.3  

Functional Class:
Amino acid biosynthesis; Serine family  

Pathway: pathway table
Glycine, serine and threonine metabolism

Secondary Evidence:
Neuwald,A.F. and Stauffer,G.V.
DNA sequence and characterization of the Escherichia coli serB gene
Nucleic Acids Res. 13 (19), 7025-7039 (1985)
M:86041894


Comment:
Oklahoma ID: NGO.1468c

For other 'ser' genes, see NG1335 (serS) and NG1283 (serC).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to phosphoserine phosphatase (SerB) sequences. Residues 72-277 are 48% similar to a phosphoserine phosphatase in Pseudomonas aeruginosa (gb|AAG08345).

Residues 1-277 are 88% similar to NMB0981 in N.meningitidis (gb|AAF41385).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0560
COG name: Phosphoserine phosphatase
Functional Class:  E
The phylogenetic pattern of COG0560 is amtky---e-Rhuj-------
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001757 (E1-E2 ATPases) with a combined E-value of 2.5e-07.
    IPB001757A    73-84
    IPB001757B    222-251
***** IPB000150 (Cof protein) with a combined E-value of 2.6e-07.
    IPB000150A    69-83
    IPB000150C    229-261


ProDom Summary:  Protein Domain Search
Residues 69-202 are 51% similar to a (PHOSPHATASE PHOSPHOSERINE HYDROLASE) protein domain (PD005736) which is seen in SERB_ARCFU.



Paralogs:  Local Blast Search


NG1468 is paralogously related to NG1312 (probable hydrolase) (7e-05).


Pfam Summary:  Pfam Search
Residues 70 to 254 (E-value = 2.8e-21) place NG1468 in the Hydrolase family which is described as haloacid dehalogenase-like hydrolase (PF00702)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1F5S|1F5S-A CRYSTAL STRUCTURE OF PHOSPHOSERINE PHOSPHATASE 127.0 3e-30
pdb|1L7O|1L7O-A CRYSTAL STRUCTURE OF PHOSPHOSERINE PHOSPHATASE 125.0 1e-29
pdb|1J97|1J97-A PHOSPHO-ASPARTYL INTERMEDIATE ANALOGUE OF 124.0 2e-29
pdb|1F5S|1F5S-A CRYS

Gene Protein Sequence:
MPQALVLQFPSAEALPSDFPSRLPEPDYADEKRMRFIVEEGFSLSEKDAA
LLDSRQIDHAVLPNMAFGELGLIVSDMDSTLITIECIDEIAAGVGLKGKV
AEITERAMRGELDFGQSLRSRVALLAGLDEQILADIYENVLKLSPGAEFL
LDECKRHNVKFLLVSGGFTFFTERLQQRLGFEYQHANILEIENGRLTGRL
KGRIIDAQAKADLLREYRSRLGLQPHQVLAMGDGANDIPILKEAGIGVAY
RAKPKARAAADACINFGGLERVRGLFG

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCGCAAGCCCTCGTCCTCCAATTTCCCTCCGCCGAAGCCCTGCCTTC
CGACTTCCCCTCACGCCTGCCCGAACCTGATTATGCTGATGAAAAGCGTA
TGCGTTTTATTGTTGAAGAAGGATTTTCTTTAAGCGAAAAAGACGCGGCG
TTACTGGACAGCCGTCAAATCGACCACGCCGTTTTGCCCAATATGGCGTT
TGGCGAACTCGGGCTGATTGTCAGCGATATGGATTCGACGCTGATTACCA
TCGAATGTATCGATGAAATTGCGGCAGGTGTGGGTTTGAAAGGCAAAGTA
GCGGAAATTACCGAGCGCGCCATGCGCGGAGAGTTGGATTTCGGACAGTC
TTTACGCAGCCGCGTTGCGTTGTTGGCGGGATTGGACGAACAGATTTTGG
CGGACATTTATGAAAACGTTTTGAAGCTCTCGCCCGGTGCGGAATTTTTG
TTGGACGAATGCAAAAGGCACAATGTGAAATTCCTGCTGGTGTCCGGCGG
GTTCACGTTTTTTACCGAAAGGCTGCAACAACGGCTCGGCTTCGAATACC
AACACGCCAATATTTTGGAAATTGAAAACGGCAGGTTGACCGGCCGTCTG
AAAGGCAGAATCATCGACGCGCAGGCAAAGGCGGATTTATTGCGCGAATA
CCGCAGCCGCCTCGGATTGCAGCCGCATCAGGTGTTGGCGATGGGCGACG
GTGCGAACGATATTCCGATACTCAAAGAAGCGGGCATAGGCGTGGCTTAC
CGCGCCAAACCGAAAGCGCGGGCCGCCGCCGATGCCTGTATCAACTTCGG
CGGTTTGGAGCGTGTACGCGGCCTGTTCGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy