Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1200 IGR1196 IGR1190 IGR1191 IGR1193 IGR1198 IGR1199 IGR1189 IGR1197 IGR1194 IGR1195 IGR1192 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1460 NG1469 NG1459 NG1457 NG1462 NG1471 NG1458 pntA, - NG1470 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1460 NG1469 NG1459 NG1457 NG1462 NG1471 NG1458 pntA, - NG1470 Type: inverse, Name:  - 157 Type: tandem, Name:  - 65 Type: tandem, Name:  - 66 Type: tandem, Name:  - 67 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1462 NG1471 NG1458 pntA, - NG1470 NG1460 NG1457 NG1459
* Calculated from Protein Sequence

Gene ID: NG1466

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
purH  

Definition:
bifunctional purine biosynthesis protein

Gene Start:
1430753

Gene Stop:
1429176

Gene Length:
1578

Molecular Weight*:
56678

pI*:
6.20

Net Charge*:
-6.07

EC:
2.1.2.3  3.5.4.10  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
One carbon pool by folate
Purine metabolism

Secondary Evidence:
Aiba,A. and Mizobuchi,K.
Nucleotide sequence analysis of genes purH and purD involved in the de novo purine nucleotide biosynthesis of Escherichia coli. J. Biol. Chem. 264 (35), 21239-21246 (1989)
M:90078227

Flannigan,K.A., Hennigan,S.H., Vogelbacker,H.H., Gots,J.S. and
Smith,J.M. Purine biosynthesis in Escherichia coli K12: structure and DNA sequence studies of the purHD locus. Mol. Microbiol. 4 (3), 381-392 (1990)
M:90286915


Comment:
Oklahoma ID: NGO.1466c

For other 'pur' genes, see NG0333 (purC), NG0398 (purA), NG0526 (purM), NG0748 (purE), NG0875 (purK), NG1183 (purL), NG1224 (purN), NG0263 (purF), NG1711 (purB), NG1939 (purD)

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to PurH proteins. Residues 4-526 are 61% similar to PUR9_HAEIN ( gb|AAC22544).

Residues 1-526 are 93% similar to NMB0983 in N.meningitidis (gb|AAF41387).

COGS Summary:  COGS Search
BeTs to 8 clades of COG0138
COG name: AICAR transformylase/IMP cyclohydrolase PurH (only IMP cyclohydrolase domain in Aful)
Functional Class:  F
The phylogenetic pattern of COG0138 is a---Yqvcebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002695 (AICARFT/IMPCHase bienzyme) with a combined E-value of 5.7e-244.
    IPB002695A    7-38
    IPB002695B    45-79
    IPB002695C    97-110
    IPB002695D    120-152
    IPB002695E    171-193
    IPB002695F    224-237
    IPB002695G    247-262
    IPB002695H    301-330
    IPB002695I    333-359
    IPB002695J    379-389
    IPB002695K    416-454
    IPB002695L    470-504
    IPB002695M    505-526


ProDom Summary:  Protein Domain Search
Residues 462-526 are 66% similar to a (FORMYLTRANSFERASE) protein domain (PD004903) which is seen in PUR9_HAEIN.

Residues 6-135 are 67% similar to a (CARBAMOYL-PHOSPHATE LARGE BIOSYNTHESIS PROTEIN) protein domain (PD002195) which is seen in PUR9_HAEIN.

Residues 136-458 are 58% similar to a (FORMYLTRANSFERASE) protein domain (PD004666) which is seen in PUR9_HAEIN.



Paralogs:  Local Blast Search


NG1466 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 131 (E-value = 1.7e-54) place NG1466 in the MGS family which is described as MGS-like domain (PF02142)
Residues 136 to 458 (E-value = 8.2e-158) place NG1466 in the AICARFT_IMPCHas family which is described as AICARFT/IMPCHase bienzyme (PF01808)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1M9N|1M9N-A CRYSTAL STRUCTURE OF THE HOMODIMERIC 250.0 3e-67
pdb|1G8M|1G8M-A CRYSTAL STRUCTURE OF AVIAN ATIC, A BIFUNCTIONAL 250.0 3e-67
pdb|1M9N|1M9N-A CRYSTAL STRUCTURE OF THE HOMODIMERIC 251.0 2e-67
pdb|1G8M|1G8M-A CRYS

Gene Protein Sequence:
MSVIKRALISLSDKAGAVEFAQNLHKLGVEILSTGGTAKLLAGAGVPVIE
VADYTGFPEMLDGRVKTLHPKIHGGILGRRDLDEHVAKMEEHGIGNIDLV
CVNLYPFAATIAKPGCTLEDAIENIDIGGPTMVRSAAKNWKHVAIVTDTA
DFPAIAAELEANNGALSDKTRFNLSRKAFSHTAQYDGMISNYLTSLSDGV
LSGEPEIGEFPSRFNQSWIKVQDMRYGENPHQRAAFYRDIDPAAGSLSAY
NQLQGKELSYNNIADADAAWEAVKSFDAPACVIVKHANPCGVAVAADTLT
AYKLAYATDTTSAFGGIIAFNREVDGETVKQITDNQFMEVLMAPKFTAEA
LEIAAAKKNVRVLEVPLKAGANRFELKRVGGGLLVQTPDINRINRADLKV
VSKRQPTEQEWNDLLFVWNVAKYVKSNAIVFGKGGQTYGIGAGQMSRVDS
TRIAARKAQDAGLDLNGACAASDAFFPFRDGVDVIAEQGIKAIIHPAGSM
RDQEVFDAADEHGIAMAVTGIRHFRH

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCGTCATCAAACGCGCCCTGATCAGCCTGTCCGACAAGGCAGGCGC
GGTCGAATTTGCCCAAAACCTGCACAAGCTCGGTGTCGAAATCCTCTCCA
CCGGCGGCACGGCGAAACTGCTTGCCGGTGCGGGCGTTCCCGTGATTGAA
GTCGCCGACTACACCGGTTTTCCCGAAATGCTCGACGGCCGCGTGAAAAC
CCTGCATCCGAAAATCCACGGCGGTATTTTGGGCCGGCGCGATTTGGACG
AACACGTCGCCAAGATGGAAGAGCACGGCATCGGCAACATCGACCTTGTG
TGTGTCAATCTTTACCCCTTCGCCGCCACCATCGCCAAGCCCGGCTGCAC
ACTGGAAGACGCGATTGAAAACATCGACATCGGCGGCCCGACTATGGTGC
GCTCCGCCGCGAAAAACTGGAAACACGTCGCCATCGTTACCGACACCGCC
GACTTCCCCGCCATTGCCGCCGAACTCGAAGCCAACAACGGCGCGTTGAG
CGATAAAACCCGCTTCAACCTCTCACGCAAAGCATTCAGCCACACCGCCC
AATACGACGGCATGATTTCCAACTATTTAACCTCGCTTTCAGACGGTGTT
TTGAGCGGAGAGCCTGAAATCGGCGAATTCCCAAGCCGGTTCAACCAAAG
CTGGATTAAAGTGCAAGACATGCGCTACGGCGAAAACCCGCATCAGCGCG
CCGCGTTTTACCGCGATATTGACCCCGCCGCAGGCAGCCTTTCCGCCTAC
AATCAACTGCAAGGCAAAGAATTGTCTTACAACAACATCGCCGATGCCGA
TGCCGCTTGGGAAGCCGTCAAATCCTTTGACGCGCCCGCCTGCGTGATCG
TGAAACACGCCAATCCGTGCGGCGTAGCCGTTGCAGCCGATACCTTGACC
GCCTACAAACTCGCCTACGCCACCGACACCACCAGCGCGTTCGGCGGCAT
CATCGCCTTCAACCGCGAAGTCGACGGCGAAACCGTCAAACAGATTACCG
ACAACCAATTTATGGAAGTCCTCATGGCGCCGAAGTTTACCGCCGAAGCC
CTTGAAATCGCCGCCGCCAAGAAAAACGTGCGCGTATTGGAAGTGCCGCT
CAAAGCAGGTGCCAACCGCTTTGAACTCAAACGCGTCGGCGGCGGACTGT
TGGTACAAACGCCCGACATCAACCGCATCAACCGCGCCGATTTGAAAGTC
GTCTCCAAACGCCAACCGACCGAGCAGGAATGGAACGATTTGCTGTTTGT
CTGGAACGTCGCAAAATACGTCAAATCCAACGCCATCGTCTTCGGCAAAG
GCGGCCAAACCTACGGTATCGGCGCAGGCCAAATGAGCCGCGTGGACAGC
ACCCGCATCGCCGCCCGCAAAGCGCAAGATGCCGGTCTCGACCTCAACGG
CGCATGTGCCGCTTCCGATGCCTTCTTCCCATTCCGCGACGGCGTGGACG
TGATTGCCGAACAGGGCATCAAAGCCATCATCCATCCGGCAGGCTCGATG
CGCGATCAGGAAGTTTTCGACGCGGCGGACGAACACGGCATCGCCATGGC
GGTAACCGGCATCCGCCACTTCCGCCAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy