Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1196 IGR1190 IGR1191 IGR1193 IGR1198 IGR1189 IGR1197 IGR1194 IGR1195 IGR1192 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1460 NG1469 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1460 NG1469 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 Type: inverse, Name:  - 157 Type: tandem, Name:  - 65 Type: tandem, Name:  - 66 Type: tandem, Name:  - 67 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 purH, - NG1466 NG1469 NG1462 NG1458 pepP, - NG1456 NG1459 NG1457 NG1460
* Calculated from Protein Sequence

Gene ID: NG1464

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
opaG  PII  

Definition:
outer membrane opacity protein; PII protein

Gene Start:
1428454

Gene Stop:
1427621

Gene Length:
834

Molecular Weight*:
31555

pI*:
10.70

Net Charge*:
21.83

EC:
 

Functional Class:
Cell envelope; Membranes, lipoproteins, and porins  
Neisseria-specific protein  

Pathway: pathway table

Primary Evidence:
Connell,T.D., Black,W.J., Kawula,T.H., Barritt,D.S., Dempsey,J.A.,
Kverneland,K. Jr., Stephenson,A., Schepart,B.S., Murphy,G.L. and
Cannon,J.G.
Recombination among protein II genes of Neisseria gonorrhoeae
generates new coding sequences and increases structural variability in the protein II family
Mol. Microbiol. 2 (2), 227-236 (1988)
MEDLINE: 88246050

Kupsch,E.M., Knepper,B., Kuroki,T., Heuer,I. and Meyer,T.F.
Variable opacity (Opa) outer membrane proteins account for the cell tropisms displayed by Neisseria gonorrhoeae for human leukocytes and epithelial cells
EMBO J. 12 (2), 641-650 (1993)
MEDLINE: 93178439

Bhat,K.S., Gibbs,C.P., Barrera,O., Morrison,S.G., Jahnig,F.,
Stern,A., Kupsch,E.M., Meyer,T.F. and Swanson,J.
The opacity proteins of Neisseria gonorrhoeae strain MS11 are
encoded by a family of 11 complete genes
Mol. Microbiol. 5 (8), 1889-1901 (1991)
MEDLINE: 92114767

van der Ley,P.
Three copies of a single protein II-encoding sequence in the genome of Neisseria gonorrhoeae JS3: evidence for gene conversion and gene duplication
Mol. Microbiol. 2 (6), 797-806 (1988)
MEDLINE: 89096501

Aho,E.L., Dempsey,J.A., Hobbs,M.M., Klapper,D.G. and Cannon,J.G.
Characterization of the opa (class 5) gene family of Neisseria
meningitidis
Mol. Microbiol. 5 (6), 1429-1437 (1991)
MEDLINE: 92157869







Secondary Evidence:
Hobbs,M.M., Malorny,B., Prasad,P., Morelli,G., Kusecek,B.,
Heckels,J.E., Cannon,J.G. and Achtman,M.Recombinational reassortment among opa genes from ET-37 complex
Neisseria meningitidis isolates of diverse geographical origins
Microbiology 144 (Pt 1), 157-166 (1998)
MEDLINE: 9812908

Comment:
From GenBank (gi:417411): This outer membrane protein is implicated in a number of adherence functions. Opa proteins are implicated in pathogenesis and are subject to phase variation.


Blast Summary:  PSI-Blast Search
Residues 32-278 are 98% similar to Z18929, outer membrane protein from Neisseria gonorrhoeae.

Residues 32-263 are 98% similar to X60710, opaG v18 from Neisseria gonorrhoeae.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
***** IPB003394 (Opacity family porin protein) with a combined E-value of 1.3e-163.
    IPB003394A    32-73
    IPB003394B    77-115
    IPB003394C    143-183
    IPB003394D    241-278


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search


NG1464 is paralogously related to NG1513 (outer membrane opacity protein) (1e-131), NG0070 (outer membrane opacity protein B (opaB)) (1e-115), NG1076 (outer membrane opacity protein) (1e-102) and NG0233 (outer membrane protein) (6e-13).


Pfam Summary:  Pfam Search
Residues 89 to 278 (E-value = 2.5e-79) place NG1464 in the Opacity family which is described as Opacity family porin protein (PF02462)

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
LICIRSTKNFSSLLFSSLLFSSLLFSSAARAAGEDHGRGPYVQADLAYAY
EHITRDYPDAAGANKGKISTVSDYFRNIRTHSIHPRVSVGYDFGGWRIAA
DYARYRKWHNNKYSVNIKELERKNNKTFGGNQLNIKYQKTEHQENGTFHA
VSSLGLSTVYDFRVNDKFKPYIGVRVGYGHVRHGIDSTKKTKNTLTAYHS
AGTKPTYYDDIDSGKNQKNTYRQNRSSRRLGFGAMAGVGIDVAPGLTLDA
GYRYHYWGRLENTRFKTHEASLGVRYRF

Gene Nucleotide Sequence:  Sequence Viewer
TTGATATGCATACGGTCGACAAAAAACTTCTCTTCTCTTCTCTTCTCTTC
TCTTCTCTTCTCTTCTCTTCTCTTCTCTTCCGCAGCGCGGGCGGCGGGTG
AAGACCATGGGCGCGGCCCGTATGTGCAGGCGGATCTGGCTTACGCCTAC
GAGCACATTACCCGCGATTATCCCGATGCAGCCGGTGCAAACAAAGGCAA
AATAAGCACGGTAAGCGATTATTTCAGAAACATCCGTACGCATTCCATCC
ACCCCAGGGTGTCGGTCGGCTACGACTTCGGCGGCTGGCGCATCGCCGCG
GATTATGCCCGTTACAGGAAATGGCACAACAATAAATATTCCGTGAACAT
AAAAGAGTTGGAAAGAAAGAATAATAAAACTTTTGGCGGCAACCAGCTTA
ACATAAAATACCAAAAGACGGAACATCAGGAAAACGGCACATTCCACGCC
GTTTCTTCTCTCGGCTTGTCAACCGTTTACGATTTCAGAGTCAACGATAA
ATTCAAACCCTATATCGGTGTGCGTGTCGGCTACGGACACGTCAGACACG
GTATCGATTCGACTAAAAAAACGAAAAATACTCTTACCGCCTACCATAGT
GCTGGCACAAAACCTACGTATTATGATGATATAGATTCGGGAAAAAACCA
AAAAAACACTTATCGCCAAAACCGCAGCAGCCGCCGCTTGGGCTTCGGCG
CGATGGCGGGCGTGGGCATAGACGTCGCGCCCGGCCTGACCTTGGACGCC
GGCTACCGCTACCACTATTGGGGACGCCTGGAAAACACCCGCTTCAAAAC
CCACGAAGCCTCATTGGGCGTGCGCTACCGCTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy