Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1196 IGR1190 IGR1191 IGR1193 IGR1198 IGR1189 IGR1197 IGR1194 IGR1195 IGR1192 IGR1188 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 NG1455 purH, - NG1466 NG1460 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 NG1455 purH, - NG1466 NG1460 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 Type: inverse, Name:  - 157 Type: tandem, Name:  - 65 Type: tandem, Name:  - 66 Type: tandem, Name:  - 67 NG1465 NG1461 serB, - NG1468 opaG,PII, - NG1464 NG1467 NG1455 purH, - NG1466 NG1462 NG1458 pepP, - NG1456 NG1459 NG1457 NG1460
* Calculated from Protein Sequence

Gene ID: NG1462

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
1427075

Gene Stop:
1427434

Gene Length:
360

Molecular Weight*:
12384

pI*:
7.00

Net Charge*:
0.00

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1462

Blast Summary:  PSI-Blast Search
No hit found in gapped BLAST.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hit to the ProDom database.

Paralogs:  Local Blast Search


NG1462 is paralogously related to NG1556 (hypothetical protein) (4e-66).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
120
transmembrane  
63  
79

PDB Hit:
No hits to the PDB database.

Gene Protein Sequence:
MDLTESAAMAGSVILKGLVEAGGNGGGGKDAPAAEIVAEGESGVDGAGAD
VFEIIAYRAYCCAFFCTGCFGIIAGDVLVGVSQIRLHIRAAPMVFTRRLP
SIRASRRGLYCMVRLSEKIG

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATTTGACGGAATCGGCGGCAATGGCGGGATCGGTAATATTGAAGGG
ATTGGTGGAGGCCGGCGGCAACGGCGGGGGCGGAAAAGACGCGCCAGCCG
CCGAAATCGTAGCCGAGGGCGAGTCGGGGGTGGACGGAGCGGGTGCGGAT
GTTTTTGAAATAATCGCTTACCGTGCTTATTGTTGTGCCTTTTTTTGCAC
CGGTTGCTTCGGGATAATCGCGGGTGATGTGCTCGTAGGCGTAAGCCAGA
TCCGCCTGCACATACGGGCCGCGCCCATGGTCTTCACCCGCCGCCTGCCA
AGCATCAGGGCGAGCAGGAGGGGTTTGTATTGCATGGTTCGGCTTTCGGA
AAAAATCGGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy