Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1191 IGR1190 IGR1193 IGR1189 IGR1187 IGR1194 IGR1195 IGR1192 IGR1188 IGR1186.1 NG1453 NG1465 NG1461 opaG,PII, - NG1464 NG1455 lysS, - NG1454 NG1460 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 NG1453 NG1465 NG1461 opaG,PII, - NG1464 NG1455 lysS, - NG1454 NG1460 NG1459 NG1457 NG1462 NG1458 pepP, - NG1456 Type: direct, Name:  - 132 Type: tandem, Name:  - 65 Type: inverse, Name:  - 158 Type: tandem, Name:  - 66 Type: tandem, Name:  - 67 Type: inverse, Name:  - 157 Type: inverse, Name:  - 169 NG1453 NG1465 NG1461 opaG,PII, - NG1464 NG1455 lysS, - NG1454 NG1462 NG1458 pepP, - NG1456 NG1459 NG1457 NG1460
* Calculated from Protein Sequence

Gene ID: NG1456

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pepP  

Definition:
aminopeptidase

Gene Start:
1422992

Gene Stop:
1424890

Gene Length:
1899

Molecular Weight*:
68796

pI*:
5.30

Net Charge*:
-14.95

EC:
3.4.13.9  

Functional Class:
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Comment:
Oklahoma ID: NGO.1456

Note similarities to eukaryotic enzymes.

For other 'pep' genes, see NG1227 (pepA, ampA), NG0158 (pepN, ampN), NG2020 (pepC).

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to Xaa-PRO aminopeptidases. Residues 46-631 are 48% similar to an aminopeptidase in Campylobacter jejuni (AL139075).

Residues 1-633 are virtually identical to NMA1640 in N.meningitidis (AL162756).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0006
COG name: Xaa-Pro aminopeptidase
Functional Class:  E
The phylogenetic pattern of COG0006 is amtKYqvcEBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001131 (Proline dipeptidase) with a combined E-value of 1.2e-22.
    IPB001131A    389-409
    IPB001131B    424-445
    IPB001131C    499-511
    IPB001131D    530-543
    IPB001131E    584-602


ProDom Summary:  Protein Domain Search
Residues 334-513 are 48% similar to a (AMINOPEPTIDASE HYDROLASE PROTEIN METHIONINE PEPTIDASE) protein domain (PD000555) which is seen in O54975_RAT.

Residues 175-294 are 30% similar to a (AMINOPEPTIDASE AMINOACYLPROLINE HYDROLASE) protein domain (PD008419) which is seen in O23206_ARATH.

Residues 43-153 are 42% similar to a (AMINOPEPTIDASE HYDROLASE P) protein domain (PD004954) which is seen in O43895_HUMAN.

Residues 573-632 are 43% similar to a (AMINOPEPTIDASE P PROTEIN P-LIKE) protein domain (PD009635) which is seen in O54975_RAT.



Paralogs:  Local Blast Search


NG1456 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
uncleavable N-terminal sequence N-terminal sequence  
1  
54
transmembrane  
247  
263

PDB Hit:
pdb|1A16|1A16 AMINOPEPTIDASE P FROM E. COLI WITH THE INHIBITOR 51.5 4e-07
pdb|1AZ9|1AZ9 AMINOPEPTIDASE P FROM E. COLI 51.5 4e-07
pdb|1JAW|1JAW AMINOPEPTIDASE P FROM E. COLI LOW PH FORM 51.5 4e-07
pdb|1AZ9|1AZ9 AMINO

Gene Protein Sequence:
LQQAGDLIIWLCFSDGISDFRPCRLKPRNLIGGSVMNTVSNYLSALREAM
KAQGLDALVIPSADPHLSEYLPEHWQARRELSGFTGSVGTFVVTADEAGV
WVDSRYWEQAAKQLSGSGIELQKSGQVPPYNEWLAANLPENAAVGIPSDM
VSLTGKRTLAQSLAAKNIRIQHPDDLLDQVWTSRPAIPAETVFIHDHAYV
SETAAEKLARVRAVMAEKGADYHLVSSLDDIAWLTNLRGSDVPFNPVFVS
FLLIGKDSAVLFTEQCRLNAEAAAALQTAGITVEPYAQVADKLAQIGGAL
LIEPNKTAVSTLVRLPESARLIEGINPSTFFKSVKSEADIARIREAMEQD
GAALCGFFAEFEDIIGKGGSLTEIDVDTMLYRHRSARPGFVSLSFDTIAG
FNANGALPHYSATPESHSTISGNGLLLIDSGAQYKGGTTDITRVVPVGTP
TAEQKRDNTLVLKAHIALAEAVFPENIPSPLIDAICRKPLWQAQCDYGHG
TGHGVSYFLNVHEGPQRIAFAAPATPETAMKKGMVTSIEPGLYRPGKWGI
RIENLAANQAVADPQETEFGSFLCFETLTLCPIDTRLMDTALMTDGEIDW
VNRYHAEVRRRLEPLTEGAAKAWLIKRTEPLAR

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAGCAGGCTGGCGATTTGATAATATGGTTATGTTTTTCAGACGGCAT
TTCAGATTTCCGTCCATGCCGTCTGAAGCCGCGAAACCTGATTGGAGGAT
CTGTTATGAATACCGTATCGAATTACCTGTCCGCATTGCGCGAAGCCATG
AAGGCGCAAGGCTTGGACGCACTCGTCATCCCTTCCGCCGACCCCCACCT
ATCCGAATACCTGCCCGAGCATTGGCAGGCGCGGCGCGAATTGTCAGGCT
TTACCGGCTCGGTCGGCACATTCGTCGTTACCGCCGATGAAGCGGGCGTA
TGGGTGGACAGCCGCTATTGGGAACAAGCCGCCAAACAGCTTTCCGGCAG
CGGCATTGAGCTGCAAAAAAGCGGGCAAGTGCCGCCGTACAACGAATGGC
TCGCGGCAAACCTGCCCGAAAACGCTGCCGTCGGCATCCCTTCCGATATG
GTGTCGCTCACCGGCAAACGCACTTTGGCGCAATCGCTCGCCGCCAAAAA
CATCCGCATCCAACACCCCGACGACCTGCTTGACCAAGTGTGGACAAGCC
GTCCCGCTATCCCCGCCGAAACCGTGTTCATCCACGACCACGCCTACGTC
TCCGAAACCGCCGCCGAGAAACTCGCCCGCGTGCGCGCAGTTATGGCGGA
AAAAGGCGCGGATTACCACTTGGTTTCCTCGCTTGACGACATCGCTTGGC
TGACCAACCTGCGCGGCAGCGACGTGCCTTTCAACCCTGTTTTCGTGTCC
TTCCTGCTGATCGGCAAAGACAGTGCCGTCCTGTTTACCGAACAATGCCG
TCTGAACGCCGAAGCCGCCGCCGCGCTACAAACCGCAGGTATCACGGTCG
AGCCTTACGCCCAAGTTGCCGACAAACTCGCGCAAATCGGCGGCGCGCTG
CTCATCGAGCCGAACAAAACCGCCGTCAGTACGCTCGTGCGCCTGCCCGA
AAGCGCGCGCCTGATTGAAGGCATCAACCCGTCCACCTTCTTCAAATCCG
TCAAATCCGAAGCCGACATCGCCCGCATCCGCGAAGCGATGGAACAAGAC
GGCGCGGCGTTGTGCGGCTTCTTCGCCGAGTTTGAAGACATCATCGGCAA
AGGCGGCAGCCTGACCGAAATCGACGTGGATACGATGCTTTACCGCCACC
GCAGCGCGCGCCCGGGTTTTGTGTCCTTGAGTTTCGACACCATCGCAGGC
TTCAACGCCAACGGTGCCCTGCCGCATTACAGCGCAACACCCGAAAGCCA
CAGCACCATCAGCGGCAACGGTCTGCTGCTCATCGACTCCGGCGCGCAAT
ACAAAGGCGGCACGACCGACATCACCCGCGTCGTCCCCGTCGGCACGCCC
ACAGCAGAACAAAAACGCGACAACACGCTCGTTCTCAAAGCCCATATCGC
GCTTGCCGAAGCCGTGTTCCCCGAAAACATCCCCTCGCCGCTGATTGACG
CGATTTGCCGCAAACCCCTGTGGCAGGCGCAATGCGACTACGGACACGGC
ACCGGCCACGGCGTAAGCTATTTCCTCAACGTCCACGAAGGCCCGCAGCG
CATCGCCTTCGCCGCCCCCGCCACGCCCGAAACCGCCATGAAAAAAGGCA
TGGTTACCTCCATCGAACCCGGCCTCTACCGTCCGGGGAAATGGGGCATC
CGCATTGAAAACCTCGCCGCCAACCAAGCCGTCGCCGACCCGCAGGAAAC
CGAGTTCGGCAGCTTCCTCTGTTTTGAAACCCTGACCCTCTGCCCCATCG
ATACACGCCTGATGGACACCGCCCTGATGACCGACGGCGAAATCGACTGG
GTCAACCGCTACCACGCCGAAGTCCGCCGCCGCCTCGAGCCGCTGACCGA
AGGCGCGGCAAAAGCGTGGCTGATCAAACGCACCGAACCGCTGGCGCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy