Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1186 IGR1185 IGR1184 IGR1189 IGR1187 IGR1183 IGR1188 IGR1186.1 NG1450 NG1453 NG1455 lysS, - NG1454 NG1457 NG1458 NG1451 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 NG1450 NG1453 NG1455 lysS, - NG1454 NG1457 NG1458 NG1451 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 Type: inverse, Name:  - 169 Type: tandem, Name:  - 65 Type: direct, Name:  - 132 Type: inverse, Name:  - 158 NG1450 NG1453 NG1455 lysS, - NG1454 NG1458 NG1451 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 NG1457
* Calculated from Protein Sequence

Gene ID: NG1454

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
lysS  

Definition:
lysyl-tRNA synthetase (LysRS)

Gene Start:
1421230

Gene Stop:
1419722

Gene Length:
1509

Molecular Weight*:
57370

pI*:
5.10

Net Charge*:
-16.14

EC:
6.1.1.6  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Lysine biosynthesis

Comment:
For other 'lys' genes see NG2098 (lysA) and NG1706 (lysR).

Oklahoma ID: NGO.1454c

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to lys-tRNA synthetases. Residues 1-503 are 57% similar to the enzyme from P.aeruginosa (gb|AAG07088).

Residues 1-503 are virtually identical to NMB1425 in N.meningitidis (gb|AAF41786).

COGS Summary:  COGS Search
BeTs to 11 clades of COG1190
COG name: Lysyl-tRNA synthetases
Functional Class:  J
The phylogenetic pattern of COG1190 is ----YQvcEbRHujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002106 (Aminoacyl-transfer RNA synthetases class-II) with a combined E-value of 1.5e-06.
    IPB002106A    196-208
    IPB002106B    477-491


ProDom Summary:  Protein Domain Search
Residues 2-84 are 44% similar to a (SYNTHETASE LYSYL-TRNA AMINOACYL-TRNA) protein domain (PD003714) which is seen in SYK1_ECOLI.

Residues 235-285 are 86% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000871) which is seen in SYK_ACICA.

Residues 421-469 are 81% similar to a (SYNTHETASE LYSYL-TRNA AMINOACYL-TRNA) protein domain (PD186099) which is seen in SYK_ACICA.

Residues 470-501 are 81% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD000848) which is seen in SYK_BACSU.

Residues 320-419 are 42% similar to a (SYNTHETASE LYSYL-TRNA AMINOACYL-TRNA) protein domain (PD110938) which is seen in SYK_ACICA.

Residues 85-220 are 58% similar to a (SYNTHETASE AMINOACYL-TRNA PROTEIN LIGASE BIOSYNTHESIS) protein domain (PD002022) which is seen in SYK2_ECOLI.

Residues 1-110 are 41% similar to a (LYSYL-TRNA SYNTHETASE EC 6.1.1.6) protein domain (PD173354) which is seen in SYK_ACICA.



Paralogs:  Local Blast Search


NG1454 is paralogously related to NG1489 (aspartyl-tRNA synthetase) (1e-11).


Pfam Summary:  Pfam Search
Residues 68 to 145 (E-value = 4.3e-21) place NG1454 in the tRNA_anti family which is described as OB-fold nucleic acid binding domain (PF01336)
Residues 161 to 502 (E-value = 5.4e-170) place NG1454 in the tRNA-synt_2 family which is described as tRNA synthetases class II (D, K and N) (PF00152)

Structural Feature(s):
Feature Type  Start  Stop
No predicted structural features.  
  

PDB Hit:
pdb|1BBU|1BBU-A LYSYL-TRNA SYNTHETASE (LYSS) COMPLEXED WITH 569.0 0e+00
pdb|1E1O|1E1O-A LYSYL-TRNA SYNTHETASE (LYSU) HEXAGONAL FOR, 566.0 0e+00
pdb|1B8A|1B8A-A ASPARTYL-TRNA SYNTHETASE 118.0 2e-27
pdb|1KRS|1KRS MOL_I

Gene Protein Sequence:
MSEQNHPQTEPQLDENQIIALRREKLNNIRQQRNAYPNDFKRDSFAADLQ
AQYGEIGKEELDPQAVPVKIAGRMMLKRQMGKASFATIQDVTGQIQLYLN
NKGVSQEVLDDFNHWDLGDIVGAEGTLFKTNHGELTVRVSDIRLLSKSLR
PLPDKHKGLSDQETKYRQRYVDLIANEESRNTFIKRSQIIQSVRNFMVGE
HYLEVETPMMHPIPGGATAKPFVTHHNALDIPLYLRIAPELYLKRLVVGG
LERVFEINRSFRNEGMSVRHNPEFTMIEFYEAFSDYERMMQMAEDIIRNA
SRTVNGTANITYNGKEVDLESPFERLTILEAIKKYNPHYTDEQLNDAEWL
KKEIVKHGESLPPSPGIGSLQLALFEGCAEGKLWNPTFIVDYPVEVSPLA
RASDTKQGLTERFELFVVGRELANGYSELNDPEDQAERFKSQVAQKDAGD
DEAMHYDADYIRAMEFGLPPTGGCGIGIDRLVMLLTDLQTIRDVILFPQM
RPE

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCGAACAAAACCATCCGCAAACCGAGCCGCAGTTGGACGAAAACCA
AATCATCGCCCTGCGCCGCGAAAAACTGAACAACATCCGCCAACAGCGCA
ACGCTTATCCCAACGATTTCAAGCGCGACAGCTTTGCCGCCGATTTGCAG
GCGCAATACGGCGAAATCGGCAAAGAAGAACTCGACCCGCAGGCCGTTCC
CGTTAAAATTGCCGGCCGCATGATGCTCAAACGTCAAATGGGCAAAGCCA
GCTTCGCCACCATTCAAGACGTTACCGGTCAAATCCAGCTTTATCTGAAC
AACAAAGGCGTGAGCCAAGAAGTTTTGGACGACTTCAACCACTGGGACTT
GGGCGACATCGTCGGTGCGGAAGGCACTTTGTTCAAAACCAACCACGGCG
AACTAACCGTGCGTGTGTCCGACATCCGCCTGCTGTCCAAATCCCTGCGT
CCGCTGCCCGACAAACACAAAGGCTTGAGCGATCAGGAAACCAAATACCG
CCAACGCTACGTCGATTTGATTGCCAATGAAGAATCGCGCAATACCTTTA
TCAAACGCAGCCAAATCATCCAATCTGTGCGTAATTTTATGGTGGGCGAG
CATTATCTCGAAGTCGAAACCCCGATGATGCACCCGATTCCCGGCGGCGC
GACAGCGAAACCCTTCGTTACCCACCACAATGCCTTGGACATTCCGCTCT
ACCTGCGCATCGCGCCCGAGCTGTATCTGAAACGCTTGGTGGTCGGCGGC
TTGGAACGCGTGTTTGAAATCAACCGCAGCTTCCGTAACGAGGGCATGTC
CGTGCGCCACAACCCCGAATTTACGATGATTGAATTTTACGAAGCCTTCT
CCGACTACGAACGTATGATGCAGATGGCGGAAGACATCATCCGCAACGCA
TCGCGCACGGTAAACGGCACGGCAAACATCACTTACAACGGCAAAGAAGT
CGATTTGGAAAGCCCGTTCGAACGTCTGACCATCCTCGAAGCCATCAAAA
AATACAATCCGCACTACACCGACGAGCAGTTGAACGATGCGGAATGGCTG
AAAAAAGAAATCGTCAAACACGGCGAAAGCCTGCCGCCGTCCCCGGGCAT
CGGCAGCCTGCAACTCGCCCTGTTTGAAGGTTGCGCCGAGGGCAAACTGT
GGAATCCGACCTTTATTGTCGATTACCCGGTCGAAGTTTCCCCGTTGGCG
CGCGCTTCGGATACGAAACAAGGTCTGACCGAACGCTTCGAGCTTTTCGT
TGTCGGGCGCGAACTGGCAAACGGCTATTCCGAGTTGAACGACCCCGAAG
ACCAAGCCGAACGCTTCAAATCGCAAGTGGCGCAAAAAGATGCGGGCGAC
GACGAAGCCATGCACTACGATGCCGACTACATCCGCGCGATGGAATTCGG
TTTGCCGCCGACCGGCGGTTGCGGCATCGGCATCGACCGCTTAGTGATGC
TGCTGACCGATTTGCAAACCATCCGCGATGTGATTCTGTTTCCGCAGATG
CGTCCCGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy