Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1186 IGR1185 IGR1184 IGR1181 IGR1187 IGR1183 IGR1182 IGR1188 IGR1186.1 NG1450 NG1453 NG1455 lysS, - NG1454 NG1451 NG1445 NG1448 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 NG1450 NG1453 NG1455 lysS, - NG1454 NG1451 NG1445 NG1448 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 Type: direct, Name:  - 132 Type: inverse, Name:  - 158 Type: inverse, Name:  - 169 NG1450 NG1453 NG1455 lysS, - NG1454 NG1451 NG1448 aspC, - NG1452 lctP, - NG1449 pepP, - NG1456 NG1447 NG1446 NG1445 NG1446 NG1447
* Calculated from Protein Sequence

Gene ID: NG1452

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
aspC  

Definition:
aspartate aminotransferase

Gene Start:
1417473

Gene Stop:
1418660

Gene Length:
1188

Molecular Weight*:
44053

pI*:
5.90

Net Charge*:
-5.99

EC:
2.6.1.1  

Functional Class:
Amino acid biosynthesis; Aspartate family  
Other categories; Other  

Pathway: pathway table
Alanine and aspartate metabolism
Alkaloid biosynthesis I
Arginine and proline metabolism
Carbon fixation
Cysteine metabolism
Glutamate metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Tyrosine metabolism

Secondary Evidence:
Fotheringham,I.G., Dacey,S.A., Taylor,P.P., Smith,T.J.,
Hunter,M.G., Finlay,M.E., Primrose,S.B., Parker,D.M. and
Edwards,R.M.
The cloning and sequence analysis of the aspC and tyrB genes from
Escherichia coli K12. Comparison of the primary structures of the
aspartate aminotransferase and aromatic aminotransferase of E. coli with those of the pig aspartate aminotransferase isoenzymes
Biochem. J. 234 (3), 593-604 (1986)
M:86242111

Kuramitsu,S., Inoue,K., Ogawa,T., Ogawa,H. and Kagamiyama,H.
Aromatic amino acid aminotransferase of Escherichia coli:
nucleotide sequence of the tyrB gene
Biochem. Biophys. Res. Commun. 133 (1), 134-139 (1985)
MEDLINE: 86076977



Comment:
Oklahoma ID: NGO.1452

For other aminotransferases, see NG0082 (avtA), NG0308 (bioA), NG0460, NG0646 (argD), NG1047 (aat), NG1241 (hisC), NG1283 (serC), NG1329 (tyrB), NG2045 (glmS).

For other 'asp' genes', see NG0556 (aspA), NG1489 (aspS) and NG1489 (aspS).

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to aspartate aminotransferases. Residues 3-396 are 74% similar to AAT_HAEIN (gb|AAC23265).

Residues 1-396 are virtually identical to NMA0719 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 3 clades of COG1448
COG name: Aspartate/aromatic aminotransferase
Functional Class:  E
The phylogenetic pattern of COG1448 is ----Y---E--h------in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001511 (Aminotransferases class-I) with a combined E-value of 2.5e-14.
    IPB001511A    66-76
    IPB001511B    177-191
    IPB001511C    244-257


ProDom Summary:  Protein Domain Search
Residues 174-393 are 78% similar to a (AMINOTRANSFERASE TRANSFERASE TRANSAMINASE ASPARTATE) protein domain (PD000504) which is seen in AAT_HAEIN.



Paralogs:  Local Blast Search


NG1452 is paralogously related to NG1329 (amino acid aminotransferase) (3e-90).


Pfam Summary:  Pfam Search
Residues 81 to 396 (E-value = 9.8e-98) place NG1452 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
305  
332

PDB Hit:
pdb|1AAW|1AAW ASPARTATE AMINOTRANSFERASE (E.C.2.6.1.1) WILD 517.0 0e+00
pdb|1ASF|1ASF ASPARTATE AMINOTRANSFERASE (E.C.2.6.1.1) MUTANT 515.0 0e+00
pdb|1IX6|1IX6-A ASPARTATE AMINOTRANSFERASE ACTIVE SITE MUTANT 515.0 0e+00
pdb|2AAT|2AAT ASPAR

Gene Protein Sequence:
MFFKHIEAAPADPILGLGEAFKAETRPEKVNLGIGVYKDASGATPIVKAV
KEAEKRLLESETTKNYLTIDGVADYNEQTQILLFGKDHEIIASRRAKTAQ
SLGGTGALRIAAEFAKRQLNAQTIWISNPTWPNHNAIAKAVGIQDKPYRY
YDAAKHCLDWDGMIEDLNQAQKGDIVLLHGCCHNPTGIDPTPEQWETLAK
LSAEKGWLPLFDFAYQGFGNGLEEDAYGLRVFLKHNTELLIASSYSKNFG
MYNERVGAFTLVAEDEETAARAHSQIKTIIRTLYSNPASHGANTIALVLK
NDDLKAQWIAELDEMRGRIKAMRQKFVELLKAKGSTQDFDFIIEQNGMFS
FSGLTPEQVDRLKNEFAIYAVRSGRINVAGITDDNIDYLCESIVKV

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCTTCAAGCACATCGAAGCCGCCCCCGCCGATCCGATTCTCGGTTT
GGGCGAAGCGTTCAAAGCCGAAACCCGCCCCGAAAAAGTCAACCTCGGCA
TCGGCGTGTACAAAGACGCATCCGGCGCGACACCCATTGTCAAAGCCGTC
AAAGAGGCTGAAAAACGCCTGTTGGAAAGCGAAACCACCAAAAATTACCT
GACCATCGACGGCGTTGCCGACTACAACGAGCAAACCCAAATCCTGCTGT
TCGGCAAAGACCACGAAATCATCGCCAGCCGCCGCGCCAAAACAGCGCAA
AGCCTTGGCGGTACAGGCGCATTGCGTATTGCGGCCGAATTTGCCAAACG
TCAGTTGAACGCGCAAACCATCTGGATTTCCAATCCGACCTGGCCAAACC
ACAACGCCATTGCCAAAGCGGTCGGTATCCAAGACAAACCTTATCGCTAC
TATGATGCCGCCAAACACTGCTTGGATTGGGACGGCATGATTGAAGATTT
GAACCAAGCGCAAAAAGGCGACATCGTCCTGCTGCACGGCTGCTGCCACA
ACCCTACCGGTATCGACCCTACGCCCGAACAATGGGAAACTTTAGCAAAA
CTTTCTGCCGAAAAAGGCTGGTTGCCATTGTTTGACTTTGCCTACCAAGG
CTTCGGCAATGGTTTGGAAGAAGATGCCTATGGCTTGCGCGTGTTCTTGA
AACACAATACAGAATTGCTGATTGCCAGCTCTTATTCCAAAAACTTCGGC
ATGTACAACGAGCGTGTCGGTGCATTCACTTTGGTGGCCGAAGATGAAGA
AACAGCAGCCCGCGCCCACAGCCAAATCAAAACCATCATCCGTACCTTGT
ATTCCAACCCGGCTTCACATGGTGCGAACACCATTGCACTGGTGTTGAAA
AATGATGATTTGAAAGCACAATGGATTGCCGAACTTGACGAAATGCGCGG
CCGCATCAAAGCCATGCGCCAAAAATTTGTCGAGTTGCTCAAGGCCAAAG
GTTCAACCCAAGACTTTGATTTTATTATTGAACAAAACGGTATGTTCTCT
TTCAGCGGCTTGACTCCCGAACAAGTTGACCGTTTGAAAAACGAGTTTGC
CATTTATGCCGTCCGTTCCGGCCGCATCAACGTCGCCGGCATTACCGACG
ACAACATCGATTATCTGTGTGAAAGCATCGTGAAAGTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy