Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1176 IGR1175 IGR1177 IGR1180 IGR1178 IGR1179 NG1440 aqpZ, - NG1439 smc, - NG1443 NG1444 pilV, - NG1441 NG1445 dsbC, - NG1438 adhA, - NG1442 NG1440 aqpZ, - NG1439 smc, - NG1443 NG1444 pilV, - NG1441 NG1445 dsbC, - NG1438 adhA, - NG1442 Type: tandem, Name:  - 64 NG1440 aqpZ, - NG1439 smc, - NG1443 pilV, - NG1441 NG1445 dsbC, - NG1438 adhA, - NG1442 NG1444
* Calculated from Protein Sequence

Gene ID: NG1442

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
adhA  

Definition:
alcohol dehydrogenase

Gene Start:
1407244

Gene Stop:
1408281

Gene Length:
1038

Molecular Weight*:
36336

pI*:
5.50

Net Charge*:
-8.33

EC:
1.1.1.1  

Functional Class:
Energy metabolism; Fermentation  

Pathway: pathway table
Bile acid biosynthesis
Fatty acid metabolism
Glycerolipid metabolism
Glycolysis / Gluconeogenesis
Tyrosine metabolism

Comment:
Oklahoma ID: NGO.1442

Blast Summary:  PSI-Blast Search
Numerous matches in gapped BLAST to alcohol dehydrogenases. Residues 1-337 are 61% similar to ADHP_ECOLI (D90789).

Residues 1-345 are 87% similar to NMA0725 in N.meningitidis (AL162754).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1064
COG name: Zn-dependent alcohol dehydrogenases
Functional Class:  R
The phylogenetic pattern of COG1064 is ----Y--cEbR-uJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002328 (Zinc-containing alcohol dehydrogenase) with a combined E-value of 3e-48.
    IPB002328A    13-44
    IPB002328B    55-80
    IPB002328C    91-105
    IPB002328D    130-177
    IPB002328D    220-267
***** IPB002364 (Quinone oxidoreductase/zeta-crystallin) with a combined E-value of 1e-09.
    IPB002364    55-82


ProDom Summary:  Protein Domain Search
Residues 147-265 are 53% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL NAD PROTEIN) protein domain (PD000104) which is seen in ADH1_ZYMMO.

Residues 61-142 are 68% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL NAD FAMILY) protein domain (PD000160) which is seen in ADH1_ZYMMO.

Residues 267-335 are 76% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL FAMILY NAD) protein domain (PD002341) which is seen in ADHP_ECOLI.

Residues 23-60 are 71% similar to a (OXIDOREDUCTASE ZINC DEHYDROGENASE ALCOHOL NAD FAMILY) protein domain (PD000163) which is seen in ADH1_ZYMMO.



Paralogs:  Local Blast Search


NG1442 is paralogously related to NG0711 (putative zinc-containing dehydrogenase) (5e-27), NG0601.1 (formaldehyde dehydrogenase) (5e-19) and NG0186 (zinc-binding alcohol dehydrogenase) (5e-10).


Pfam Summary:  Pfam Search
Residues 9 to 336 (E-value = 6.5e-108) place NG1442 in the ADH_zinc_N family which is described as Zinc-binding dehydrogenase (PF00107)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
82
non-globular  
171  
346

PDB Hit:
pdb|1JVB|1JVB-A ALCOHOL DEHYDROGENASE FROM THE ARCHAEON 145.0 2e-35
pdb|1HT0|1HT0-A HUMAN GAMMA-2 ALCOHOL DEHYDROGENSE 109.0 7e-25
pdb|1HDY|1HDY-A ALCOHOL DEHYDROGENASE (E.C.1.1.1.1) (BETA-2 108.0 2e-24
pdb|1HTB|1HTB-A CRYS

Gene Protein Sequence:
MQAVVVNKNVAGDVEVVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDY
GEKPGRVLGHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTG
RETLCRSVLNAGYTADGGMATHCIVSADYAVKVPEGLDPAQASSITCAGV
TTYKAIKVSGVRPGQWIAIYGAGGLGNLGVQYAKKVFGTHVVAIDINDDK
LAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVSAAAFNSAVNC
VRAGGRVVAVGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCDHHH

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAGGCAGTTGTTGTGAATAAAAATGTAGCGGGCGATGTGGAAGTAGT
CGAACGCGAGGTTCGCCCGTTGGAATACGGCGAGGCATTGGTCGAAGTCG
AATATTGCGGCGTGTGCCATACCGACCTGCACGTTGCGGCAGGCGACTAC
GGCGAAAAACCGGGCCGCGTGCTGGGACACGAGGGCATCGGTTTGGTTAA
AGAAGTTGCCGACGGTGTGAAAAATCTGAAAGTCGGCGACCGCGTCAGCA
TCGCCTGGCTGTTCCAAAGCTGCGGCTCTTGCGAATACTGCAATACCGGC
CGCGAAACCCTGTGCCGTTCCGTATTGAACGCGGGCTACACCGCCGACGG
CGGTATGGCGACCCACTGCATCGTGAGTGCCGATTACGCGGTCAAAGTCC
CTGAAGGTTTGGATCCTGCGCAAGCTTCCAGCATTACTTGTGCCGGCGTG
ACCACTTATAAAGCCATTAAAGTTTCCGGCGTTCGTCCTGGTCAATGGAT
TGCGATTTACGGCGCGGGCGGCTTGGGCAACTTGGGTGTCCAATACGCGA
AAAAAGTATTCGGCACGCACGTTGTCGCCATCGACATCAACGACGACAAG
CTGGCATTTGCCAAAGAAACCGGCGCGGATTTGGTTGTCAACGCCGCCAA
AGAGGACGCTGCCAAAGTGATTCAGGAAAAAACCGGCGGCGCACACGCTG
CGGTCGTAACCGCCGTATCTGCTGCCGCATTCAACTCTGCCGTGAATTGC
GTCCGCGCGGGCGGACGTGTGGTTGCCGTCGGGCTGCCGCCGGAATCGAT
GGATTTGTCCATCCCGCGTTTGGTTTTGGACGGCATCGAAGTGGTCGGCT
CTTTGGTCGGCACGCGCAAAGATTTGGAAGAAGCCTTCCAATTCGGCGCG
GAAGGTTTGGTTGTGCCGAAAGTCCAACTGCGTGCTTTGGATGAAGCACC
CGCCATTTTCCAAGAAATGCGCGAAGGCAAAATCACCGGCCGTATGGTGA
TCGATATGAAAAAAGAATGCGGCTGCGATCATCACCAC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy