Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Neisseria gonorrhoeae Search Results

Record: 1 of 1  
MiniMap IGR1155 IGR1156 IGR1159 IGR1163 IGR1160 IGR1164 IGR1165 IGR1163.1 IGR1158 IGR1161 IGR1157 IGR1162 IGR1166 NG1426 NG1425 grpE, - NG1422 NG1427 aarF, - NG1424 NG1419 NG1421 NG1428 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 dnaK, - NG1429 NG1426 NG1425 grpE, - NG1422 NG1427 aarF, - NG1424 NG1419 NG1421 NG1428 nqrE, - NG1417 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 dnaK, - NG1429 NG1425 grpE, - NG1422 NG1427 aarF, - NG1424 NG1426 NG1419 NG1421 NG1428 nqrD, - NG1416 sat, - NG1423 apbE, - NG1420 nqrF, - NG1418 dnaK, - NG1429 nqrE, - NG1417
* Calculated from Protein Sequence

Gene ID: NG1423

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sat  

Definition:
serine-O-acetyltransferase

Gene Start:
1385547

Gene Stop:
1386362

Gene Length:
816

Molecular Weight*:
29307

pI*:
7.00

Net Charge*:
0.00

EC:
2.3.1.30  

Functional Class:
Amino acid biosynthesis; Serine family  
Central intermediary metabolism; Sulfur metabolism  

Pathway: pathway table
Cysteine metabolism
Sulfur metabolism

Secondary Evidence:
Wigley,D.B., Derrick,J.P. and Shaw,W.V.
The serine acetyltransferase from Escherichia coli.
Over-expression, purification and preliminary crystallographic
analysis.
FEBS Lett. 277 (1-2), 267-271 (1990)
M:91099514


Hindson,V.J., Moody,P.C., Rowe,A.J. and Shaw,W.V.
Serine acetyltransferase from Escherichia coli is a dimer of
trimers.
J. Biol. Chem. 275 (1), 461-466 (2000)
M:20085066


Comment:
Oklahoma ID: NGO.1423

Blast Summary:  PSI-Blast Search
Several matches in gapped BLAST to serine O-acetyltransferase (EC 2.3.1.30). Residues 13-262 are 56% similar to CYSE_ECOLI (gb|AAA23648).

Residues 1-272 are virtually identical to NMA0742 in N.meningitidis (gb|AAF40988).

COGS Summary:  COGS Search
BeTs to 6 clades of COG1045
COG name: Serine acetyltransferase
Functional Class:  E
The phylogenetic pattern of COG1045 is ------vcebrhuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001451 (Bacterial transferase hexapeptide repeat) with a combined E-value of 7.9e-20.
    IPB001451    200-235
    IPB001451    194-229
    IPB001451    206-241


ProDom Summary:  Protein Domain Search
Residues 13-108 are 45% similar to a (SERINE TRANSFERASE ACETYLTRANSFERASE) protein domain (PD005265) which is seen in CYSE_ECOLI.

Residues 109-246 are 67% similar to a (TRANSFERASE ACYLTRANSFERASE PROTEIN REPEAT BIOSYNTHESIS) protein domain (PD000343) which is seen in Q42532_ARATH.



Paralogs:  Local Blast Search


NG1423 is paralogously related to NG0085 (pilin glycosylation protein) (3e-06) and NG2125 (possible acetyltransferase) (8e-04).


Pfam Summary:  Pfam Search
Residues 13 to 117 (E-value = 3.4e-61) place NG1423 in the SATase_N family which is described as Serine acetyltransferase, N-terminal (PF06426)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
143  
272

PDB Hit:
pdb|1KQA|1KQA-A GALACTOSIDE ACETYLTRANSFERASE IN COMPLEX WITH 58.2 2e-09
pdb|1HM0|1HM0-A CRYSTAL STRUCTURE OF S.PNEUMONIAE 47.3 3e-06
pdb|1G95|1G95-A CRYSTAL STRUCTURE OF S.PNEUMONIAE GLMU, APO FORM 45.3 1e-05
pdb|1KHR|1KHR-A CRYS

Gene Protein Sequence:
MKKNHLNTTGFDLWHTIREETAAAAAAEPMLASFLHQTVLRHESLGSVLA
YHLSSKLGSPIMDVRALFEIYQQALGSDTQISKCVEADLKAIYERDPACD
EYSLPLLYFKGFHAIQAHRINHRLYLDGRKTLAYFLQNRMSEVFGVDIHP
AARLGYGLMLDHATGFVAGETAVLGNNISILHGVTLGGSGKEGGDRHPKI
GDGVMIGANASILGNIRIGSNAKIGAGSVVVSDVPPSITVVGVPAKPVAR
SLKTPSADMDQNIQFAEIDFMI

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAAACCATTTGAACACAACCGGTTTCGACCTCTGGCACACCAT
CCGCGAAGAAACCGCGGCCGCTGCCGCCGCCGAACCGATGCTGGCAAGTT
TTTTGCACCAAACCGTGTTGCGCCACGAGTCCCTCGGCTCCGTCCTTGCC
TACCACCTTTCCAGCAAACTCGGCAGCCCGATTATGGACGTGCGCGCGCT
GTTTGAAATTTACCAGCAGGCATTGGGCAGCGACACCCAAATCAGCAAAT
GTGTCGAAGCAGACTTAAAAGCCATCTACGAACGCGATCCCGCCTGCGAC
GAATATTCGCTGCCGCTTTTATATTTCAAAGGCTTCCACGCGATTCAGGC
ACACCGCATCAACCACCGGCTGTATCTCGACGGACGCAAAACGCTGGCGT
ATTTCCTACAAAACCGTATGTCCGAAGTATTCGGCGTGGACATCCATCCC
GCCGCCCGTTTAGGATACGGGCTGATGCTCGACCACGCCACCGGCTTTGT
TGCCGGAGAAACCGCCGTGTTGGGCAACAATATTTCGATTTTGCACGGCG
TAACGCTCGGCGGTTCGGGCAAAGAAGGCGGCGACCGCCACCCCAAAATC
GGCGACGGCGTGATGATCGGCGCAAACGCCTCGATATTGGGCAATATCCG
CATCGGCAGCAATGCCAAAATCGGCGCGGGCAGCGTCGTGGTTTCAGACG
TGCCGCCGTCCATCACGGTTGTCGGCGTACCCGCCAAACCCGTGGCGCGA
TCGCTCAAAACCCCGTCGGCGGATATGGATCAAAATATCCAGTTTGCCGA
AATCGACTTTATGATT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy